KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0622Help
Entry
SAHV_0622         CDS       T00588                                 

Definition
(GenBank) MnhD homologue
  KO
K05568  
multicomponent Na+:H+ antiporter subunit D
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Brite
Transporters [BR:saw02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   SAHV_0622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
698814..700310
Genome map
AA seq 498 aa AA seqDB search
MLSNLLILPMLLPFLCALILVFLKNNDRISKYLYLGTMTITTIISLMLLIYVQRHRPITL
DFGGWSAPFGIQFLGDSLSLIMVTTASFVITLIMAYGFGRGEHKANRYHLPSFILFLSVG
VIGSFLTSDLFNLYVMFEIMLLASFVLITLGQSVEQLRAAIIYVVLNIIGSWLFLLGIGL
LYKTVGTLNFSHIAMRLNDMGDNRTVTMISLIFLVAFSAKAALVLFMWLPKAYAVLNTEL
AALFAALMTKVGAYALIRFFTLLFDQHNDLIHPLLATMAAITMVIGAIGVIAYKDIKKIA
AYQVIISIGFIILGLGTNTFAGINGAIFYLVNDIVVKTLLFFIIGSLVYITGYRQYQYLN
GLAKKEPLFGVAFIIMIFAIGGVPPFSGFPGKVLIFQGALQNGNYIGLALMIITSLIAMY
SLFRIFFYMYFGDKDGEEVNFKKIPLYRKRILSILVVVVIAIGIAAPVVLNVTSDATELN
TSDQLYQKLVNPHLKGED
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgctaagtaacttattgattttaccaatgttattaccattcctttgtgccttaatcctt
gtatttttaaaaaataatgatcgtatttctaaatatttatacttaggtacaatgactatc
accacaattatttcattaatgctattaatttatgttcagcgtcaccgtccaattacgcta
gactttggaggatggtcagcgccctttggtatacagtttttaggagattctttaagtttg
attatggttacaaccgcttcgtttgtgattactttaattatggcatacggatttgggcgt
ggcgaacataaagcaaatcgttatcacttgccatcgttcatattatttttaagtgttggc
gtgataggctcttttctaacatcagatttatttaatttatacgtcatgtttgaaattatg
ttactagcgtcatttgtactcattacacttggacaatctgtagaacaattacgtgctgca
attatttatgttgtcttgaatattattggttcatggctattcttattaggtataggttta
ctttataaaacagtaggtacattaaacttttcacatattgcaatgcgtttgaatgacatg
ggagataatcgcactgttacaatgatttcattaatcttcttagtcgcatttagtgcgaaa
gcagcgctggtcctttttatgtggctacccaaagcctacgctgtgttaaatactgagctt
gcagcattatttgcagcgttaatgaccaaagtaggggcctatgcattaattcgattcttc
actttactatttgatcaacataatgatctcatacatccattgctagcaactatggctgct
ataactatggtcatcggcgctataggtgtcattgcttataaagatattaaaaagattgca
gcttaccaagtcataatctcaataggatttatcattttaggtttaggaacaaacacgttt
gcaggtattaatggtgcaatattttatttggtaaatgacattgttgtaaaaacattgcta
ttctttattattggtagtttagtttacattacaggctatcgacaatatcaatatttgaat
ggcttagctaaaaaagaacctttatttggagttgcgtttattataatgatttttgctatt
ggcggcgtgcctccatttagtggctttccggggaaagtacttattttccaaggtgcattg
caaaatggcaattatattggactagcgttaatgattattactagtctaattgcaatgtac
agtttatttaggatatttttttatatgtattttggagataaagatggggaggaagttaat
tttaagaaaatcccgctatatcgaaaaagaattttaagtattttagtagttgtggttatc
gcaatcggaattgctgcacctgttgtgttaaatgttacaagtgatgcaactgagttgaac
acgagtgatcaattatatcaaaaacttgtaaatccgcatttgaaaggagaggactaa

DBGET integrated database retrieval system