KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0639Help
Entry
SAHV_0639         CDS       T00588                                 

Gene name
pbp4
Definition
(GenBank) penicillin binding protein 4
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
saw00550  Peptidoglycan biosynthesis
saw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saw00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SAHV_0639 (pbp4)
Enzymes [BR:saw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SAHV_0639 (pbp4)
Peptidases [BR:saw01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   SAHV_0639 (pbp4)
Peptidoglycan biosynthesis and degradation proteins [BR:saw01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   SAHV_0639 (pbp4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 DUF1958 Beta-lactamase2 Beta-lactamase Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: BAF77522
Structure
PDB: 

Jmol
Position
complement(716382..717677)
Genome map
AA seq 431 aa AA seqDB search
MKNLISIIIILCLTLSIMTPYAQATNSDVTPVQAANQYGYAGLSAAYEPTSAVNVSQTGQ
LLYQYNIDTKWNPASMTKLMTMYLTLEAVNKGQLSLDDTVTMTNKEYIMSTLPELSNTKL
YPGQVWTIADLLQITVSNSSNAAALILAKKVSKNTSDFVDLMNNKAKAIGMKNTHFVNPT
GAENSRLRSFAPTKYKDQERTVTTARDYAILDLHVIKETPKILDFTKQLAPTTHAVTYYT
FNFSLEGAKMSLPGTDGLKTGSSDTANYNHTITTKRGKFRINQVIMGAGDYKNLGGEKQR
NMMGNALMERSFDQYKYVKILSKGEQRINGKKYYVENDLYDVLPSDFSKKDYKLVVEDGK
VHADYPREFINKDYGPPTVEVHQPIIQKANTVAKSMWEEHPLFTIIGGACLVAGLALIVH
MIINRLFRKRK
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttaatatctattatcatcattttatgtttaacattaagtattatgacacca
tatgcacaagctactaacagtgacgtaacccctgtacaagcagcaaatcaatatggttat
gcaggtttgtcggctgcatacgaaccgacgagtgctgttaatgtaagtcaaactggacaa
ttactgtatcaatacaatatcgatactaagtggaatccagcgtctatgactaaattaatg
acaatgtacttaacattggaagctgtaaataaggggcagctttcacttgatgacacagtc
acaatgacgaacaaagaatatattatgtctacactacctgagttgagtaatacgaaacta
tatcctggacaagtatggacaatcgcagacctattacaaattacagtatctaattctagt
aatgccgcggcattaattttagctaagaaggtatcaaaaaacaccagcgatttcgttgat
ttaatgaataacaaagctaaagctatcggaatgaaaaatacacatttcgtcaatccaacg
ggtgctgaaaattcaagattacgttcatttgcaccaacaaagtataaagaccaagaacgt
actgtaacgactgctagagactatgccattttagatttacacgtgattaaagagacacct
aaaatattagactttacaaagcagttagcaccaacaacgcatgcagttacgtattacaca
ttcaacttttcattggaaggtgcaaaaatgagtttgcctggtacagatggtttaaaaact
ggatcaagtgatacagcaaattacaaccatacgattactaccaaacgaggtaaatttaga
attaatcaagttatcatgggtgcaggagactataaaaaccttggtggcgagaagcaacgt
aatatgatggggaatgcattaatggaacgctcatttgatcagtataaatatgtaaaaata
ttgtctaaaggtgagcaaaggataaatggtaagaaatattatgttgaaaatgatctttac
gatgttttaccaagtgattttagtaaaaaagattataaacttgtagtcgaagatggtaaa
gtacacgcggactatccaagagaatttattaataaagattatggacctccaactgtagaa
gttcatcagccaattattcaaaaggcaaatactgttgctaaaagtatgtgggaagaacat
ccattattcactatcattggtggtgcatgccttgtcgctggattagcacttattgttcat
atgataatcaatcgtttatttagaaaaagaaaataa

DBGET integrated database retrieval system