KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0642Help
Entry
SAHV_0642         CDS       T00588                                 

Definition
(GenBank) hypothetical protein
  KO
K16323  
purine nucleoside transport protein
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Brite
Transporters [BR:saw02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   SAHV_0642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
720182..721411
Genome map
AA seq 409 aa AA seqDB search
MFLLINIIGLIVFLGIAVLFSRDRKNIQWQSIGILVVLNLFLAWFFIYFDWGQKAVRGAA
NGIAWVVQSAHAGTGFAFASLTNVKMMDMAVAALFPILLIVPLFDILMYFNILPKIIGGI
GWLLAKVTRQPKFESFFGIEMMFLGNTEALAVSSEQLKRMNEMRVLTIAMMSMSSVSGAI
VGAYVQMVPGELVLTAIPLNIVNAIIVSCLLNPVSVEEKEDIIYSLKNNEVERQPFFSFL
GDSVLAAGKLVLIIIAFVISFVALADLFDRFINLITGLIAGWIGIKGSFGLNQILGVFMY
PFALLLGLPYDEAWLVAQQMAKKIVTNEFVVMGEISKDIASYTPHHRAVITTFLISFANF
STIGMIIGTLKGIVDKKTSDFVSKYVPMMLLSGILVSLLTAAFVGLFAW
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtttttattaatcaacattattggtctaattgtatttcttggtattgcggtattattt
tcaagagatcgcaaaaatatccaatggcaatcaattgggatcttagttgttttaaacctg
tttttagcatggttctttatttattttgattggggtcaaaaagcagtaagaggagcagcc
aatggtatcgcttgggtagttcagtcagcgcatgctggtacaggttttgcatttgcaagt
ttgacaaatgttaaaatgatggatatggctgttgcagccttattcccaatattattaata
gtgccattatttgatatcttaatgtactttaatattttaccgaaaattattggaggtatt
ggttggttactagctaaagtaacaagacaacctaaattcgagtcattctttgggatagaa
atgatgttcttaggaaatactgaagcattagccgtatcaagtgagcaactaaaacgtatg
aatgaaatgcgtgtattaacaatcgcaatgatgtcaatgagctctgtatccggagctatt
gtaggtgcgtatgtacaaatggtaccaggagaactggtactaacggcaattccactaaat
atcgttaacgcgattattgtgtcatgcttgttgaatccagtaagtgttgaagagaaagaa
gatattatttacagtcttaaaaacaatgaagttgaacgtcaaccattcttctcattcctt
ggagattctgtattagcagcaggtaaattagtattaatcatcatcgcatttgttattagt
tttgtagcgttagctgatctatttgatcgttttatcaatttgattacaggattgatagca
ggatggataggcataaaaggtagtttcggtttaaaccaaattttaggtgtgtttatgtat
ccatttgcgctattactcggtttaccttatgatgaagcgtggttggtagcacaacaaatg
gctaagaaaattgttacaaatgaatttgttgttatgggtgaaatttctaaagatattgca
tcttatacaccacaccatcgtgcggttattacaacattcttaatttcatttgcaaacttc
tcaacgattggtatgattatcggtacattgaaaggcattgttgataaaaagacatcagac
tttgtatctaaatatgtacctatgatgctattatcaggtatcctagtttcattattaaca
gcagctttcgttggtttatttgcatggtaa

DBGET integrated database retrieval system