KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0643Help
Entry
SAHV_0643         CDS       T00588                                 

Definition
(GenBank) conserved hypothetical protein
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
722158..722769
Genome map
AA seq 203 aa AA seqDB search
MYLTILVTILISIFLSLTESWQVETGNSIVNAIFGGVSVGLGIGVIILAGGTTAGTTILA
RIATKYLDVSTPYALLFFDMIVVAISLTVIPLDKVLVTVISLYIGTKVMEYVIEGLNTKK
AMTIISTNPDKLAKAIDEQIGRGLTILNGHGYYTREEKDVLYVVISKTQVSKAKRLIKQI
DKDAFLVIHDVRDVYGNGFLADE
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtacttaactattcttgtaacaattcttatttcaatatttttgagtttaacagaatca
tggcaagtagaaactggaaacagcattgtgaatgccatttttggtggtgtaagcgttgga
ctaggaatcggagtaattatccttgcaggcggtacaacagcaggtacaacaattttggcg
agaattgcaacgaaatacctcgatgtaagcacgccatatgctttgcttttcttcgatatg
atcgttgttgcaatttcacttacagttattccacttgataaagtattagtaacagtaata
tcactttatataggaacaaaagtgatggaatatgtcatagaaggtttaaacactaaaaaa
gctatgacgattatttcaactaatcccgacaaacttgccaaagcaatagacgagcaaatt
ggaagaggtttaaccattttaaacggacatggctattatacgcgtgaagaaaaagatgtc
ttatacgttgttatttctaaaacacaagtttcaaaagcaaagcgattaattaaacaaatc
gataaagatgcattcctcgtaattcatgatgtaagagatgtctatggtaatggctttctt
gcagatgaataa

DBGET integrated database retrieval system