KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0651Help
Entry
SAHV_0651         CDS       T00588                                 

Definition
(GenBank) conserved hypothetical protein
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Position
729241..730221
Genome map
AA seq 326 aa AA seqDB search
MQFFTKYGLWAYLGVIISGFILAFIGRQVAKIGTAFEATNHESTLQYVFGEKFSKVFDYI
LIFFLFGIAVTMIAGAGATFEESYNIPTWLGALIMTLAIYITLLLDFNKIVRALGIVTPF
LIVLVVLIAGVYLFKGHVSLAEVNQVVPEASIWKGIWFGTIYGGLAFSVGFSTIVAIGGD
TEKRTVSGAGAMYGGIIYTVLLALINFALQSEYPTIKNASIPTLTLANNIHPLIATVLSV
IMLAVMYNTILGLMYSFAARFTEPYSKNYHIFIIIMMVAGYLLSFVGFAELINKLYTIMG
YVGLFIVVAVIIKYFKRKNADKKHIA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttttcactaaatatggcttgtgggcttatttaggtgttattatatctggtttt
attttagcttttattgggcgccaagtagcaaaaattggtactgcctttgaagcgacaaac
catgaatcaacattacaatacgtattcggtgaaaagtttagtaaagtctttgattatatt
ttaatcttcttcttatttggtatagctgtaaccatgatagctggtgcaggcgcaacattt
gaagaaagttataacatacctacatggctaggtgctttaattatgacattagcgatttat
attacgttgctattagactttaataaaatagtacgtgcacttggtatcgttacaccattt
ttaattgttttagttgtattaatcgctggcgtttatttatttaaaggtcatgtttcatta
gcagaagttaaccaagtagtgcctgaagcaagtatttggaagggaatctggtttggtaca
atatatggtggattagctttttctgtaggttttagtaccatcgtagcaatcggtggggat
acagaaaagcgtacagtgtcaggtgcaggcgcgatgtatggtggtattatctatactgta
ttactagcattgatcaactttgcattgcaaagtgaatatccaactattaaaaatgcctca
attccaacattgacgttagcaaataatatccatcctttaatagcaacagtgttatctgtt
attatgctggcggttatgtataatactattctaggactaatgtattcatttgcagcacgt
tttacagaaccatacagtaaaaattatcatatctttattattataatgatggtagcaggt
tatttattaagtttcgtaggatttgctgaattaattaataagttatatacaattatggga
tatgtaggcttatttattgtagtagctgtaattattaaatatttcaaacgtaaaaatgcg
gataaaaaacatattgcttaa

DBGET integrated database retrieval system