KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0652Help
Entry
SAHV_0652         CDS       T00588                                 

Definition
(GenBank) hypothetical protein
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
730372..731415
Genome map
AA seq 347 aa AA seqDB search
MNKDNKWTMITALFITVISVLLTFHLKQHYDQITNENHANKDKINIKNKNVRIYQNLTYN
RVFPNSKLDIITPVDMSSNAKLPVIFWMHGGGYIAGDKQYKNPLLAKIAEQGYIVVNVNY
ALAPQYKYPTPLIQMNQATQFIKENKMNLPIDFNQVIIGGDSAGAQLASQFTAIQTNDRL
REAMKFDQSFKPSQIKGAILFGGFYNMQTVRETEFPRIQLFMKSYTGEEDWEKSFKNISQ
MSTVKQSTKNYPPTFLSVGDSDPFESQNIEFSKKLQELNVPVDTLFYDGTHHLHHQYQFH
LNKPESIDNIKKVLLFLSRNTSSSGIQTEEKPQMENPSNELPLNPLN
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagataataaatggacgatgataactgcgctttttataactgtaatcagtgta
ttgttaacatttcatctgaaacaacattatgaccaaattacaaatgagaaccatgctaat
aaagacaaaattaatattaaaaataaaaatgtgcgcatttatcaaaaccttacatacaat
agagttttccctaacagtaaattagatattattacacctgttgatatgtcttctaatgcc
aaactgccagttattttttggatgcacggtggtggttatattgcgggtgataagcagtat
aaaaacccattattagcgaaaattgctgaacaagggtacattgttgtgaatgtaaattat
gcattggcgccacaatataaatatcccacaccattaattcaaatgaatcaagcaactcaa
ttcattaaagaaaataaaatgaatttacctattgattttaatcaagtaattattggcggt
gattctgcaggtgctcaattagctagccaatttacggcaatacagacgaatgatcgctta
agagaagccatgaaatttgatcagtcattcaaaccatcgcaaattaaaggtgctatacta
tttggtggtttttataatatgcaaacagttagagaaactgagtttccaagaatacagtta
tttatgaaaagttatactggcgaagaagattgggaaaagagctttaaaaatatttcacaa
atgtcgacagtaaaacaatcgacaaaaaattatccaccaacatttttatctgttggagat
agcgatccattcgaaagtcaaaatatagaattcagtaagaaattacaagaattgaatgta
ccagtagatactttgttttatgatggtacgcatcatttacatcatcagtatcaatttcac
cttaataaacctgaatcgatagataacatcaaaaaagtgttacttttcttaagtcgtaat
acatcttctagtggtattcaaactgaagagaaaccacaaatggaaaatccgagtaatgaa
ttaccgttaaatcctttaaactaa

DBGET integrated database retrieval system