KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0656Help
Entry
SAHV_0656         CDS       T00588                                 

Gene name
graR
Definition
(GenBank) two-component response regulator
  KO
K19078  
two-component system, OmpR family, response regulator protein GraR
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
Cationic antimicrobial peptide (CAMP) resistance
Two-component system
Module
Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon
Cationic antimicrobial peptide (CAMP) resistance, lysyl-phosphatidylglycerol (L-PG) synthase MprF
Cationic antimicrobial peptide (CAMP) resistance, VraFG transporter
GraS-GraR (cationic antimicrobial peptide transport) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:saw00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SAHV_0656 (graR)
 Human Diseases
  Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    SAHV_0656 (graR)
Two-component system [BR:saw02022]
 OmpR family
  GraS-GraR [MD:M00733]
   SAHV_0656 (graR)
Antimicrobial resistance genes [BR:saw01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    SAHV_0656 (graR)
   Cationic antimicrobial peptide (CAMP) resistance, lysyl-phosphatidylglycerol (L-PG) synthase MprF [MD:M00726]
    SAHV_0656 (graR)
   Cationic antimicrobial peptide (CAMP) resistance, VraFG transporter [MD:M00730]
    SAHV_0656 (graR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
733939..734613
Genome map
AA seq 224 aa AA seqDB search
MQILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKYDGF
YWCRKMREVSNVPILFLSSRDNPMDQVMSMELGADDYMQKPFYTNVLIAKLQAIYRRVYE
FTAEEKRTLTWQDAVVDLSKDSIQKGDDTIFLSKTEMIILEILITKKNQIVSRDTIITAL
WDDEAFVSDNTLTVNVNRLRKKLSEISMDSAIETKVGKGYMAHE
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatactactagtagaagatgacaatactttgtttcaagaattgaaaaaagaatta
gaacaatgggattttaatgttgctggtattgaagatttcggcaaagtaatggatacattt
gaaagttttaatcctgaaattgttatattggatgttcaattacctaaatatgatgggttt
tattggtgcagaaaaatgagagaagtttccaacgtaccaatattatttttatcatctcgt
gataatccaatggatcaagtgatgagtatggaacttggcgcagatgattatatgcaaaaa
cctttctataccaatgtattaattgctaaattacaagcgatttatcgtcgtgtctatgag
tttacagctgaagaaaaacgtacattgacttggcaagatgctgtcgttgatctatcaaaa
gatagtatacaaaaaggtgacgatacgatttttctatccaaaacagaaatgattatatta
gaaattcttattaccaaaaaaaatcaaatcgtttcgagagatacaattatcactgcatta
tgggatgatgaagcatttgttagtgataatacgttaacagtaaatgtgaatcgtttacga
aaaaaattatctgaaattagtatggatagtgcaatcgaaacaaaagtaggaaaaggatat
atggctcatgaataa

DBGET integrated database retrieval system