KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0666Help
Entry
SAHV_0666         CDS       T00588                                 

Definition
(GenBank) conserved hypothetical protein
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
747001..747441
Genome map
AA seq 146 aa AA seqDB search
MLIVDALTNNVNRTASDVRAAFGKNGGNMGVSGSVAYMFDHVATFGIEGKSVDEILETLM
EQDVDVNDVIDDNGLTIVYAEPDQFAVVQDALRAAGVEEFKVAEFEMLPQTDIELSEADQ
VTFEKLIDALEDLEDVQNVFHNVDLK
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgctaattgttgatgcgttaacaaataatgtaaatcgtactgcctctgatgtgcgagct
gcttttggtaaaaacggcggtaatatgggtgtatctggatcagttgcttatatgtttgat
catgtggcaacatttggtattgaaggaaagtctgttgacgaaatacttgaaacattaatg
gaacaagatgtagatgtaaatgatgtgattgacgataatggattgacaatagtctatgct
gaaccagatcaatttgcagtcgttcaagatgcgcttcgtgcagcaggtgttgaagaattt
aaagttgctgaatttgaaatgttacctcaaacagatattgaactttctgaagcggaccaa
gtaacatttgaaaaattaatcgatgcattagaagatttagaagatgtacaaaacgtattc
cataatgtggatttgaaataa

DBGET integrated database retrieval system