KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0667Help
Entry
SAHV_0667         CDS       T00588                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09705  
uncharacterized protein
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
747726..747914
Genome map
AA seq 62 aa AA seqDB search
MQYVVPKGTIFASSIEISNTYSLVGCMCQPAFEFKQFELFKQSELITQYPHLKSVIEKYA
LK
NT seq 189 nt NT seq  +upstreamnt  +downstreamnt
ttgcaatatgtagtgcctaaaggaacaatttttgcttcttcaatcgaaatttcaaatact
tatagtttagtaggttgtatgtgtcaaccggcatttgagtttaagcagtttgaattgttt
aagcaatctgaattaattacacaatatccgcatcttaaatcagtgattgaaaaatatgct
ttaaaataa

DBGET integrated database retrieval system