KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0955Help
Entry
SAHV_0955         CDS       T00588                                 

Gene name
argH
Definition
argininosuccinate lyase
Orthology
K01755  
argininosuccinate lyase [EC:4.3.2.1]
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:saw01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:saw00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:saw00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1003669..1005048)
Genome map
AA seq 459 aa AA seqDB search
MSNKAWGGRFEVQPEEWVDDFNASITFDQTLIDQDIEGSIAHATMLANQGIISQQDSEQI
IQGLKSIQHDYHQDQIQFSASLEDIHLNIEHELIKRIGDAGGKLHTGRSRNDQVATDMHL
YTKKQVQDIIALIKSLQSVIVDIASNNVDTIMPGYTHLQRAQPISFAHHIMTYFWMLQRD
QQRFEDSLKRIDINPLGAAALSGTTYPIDRHETTALLNFGSLYENSLDAVSDRDYIIETL
HNISLTMVHLSRFAEEIIFWSTDEAKFITLSDAFSTGSSIMPQKKNPDMAELIRGKVGRT
TGHLMSMLMTLKGLPLAYNKDMQEDKEGLFDAVHTIKGSLRIFEGMIQTMTINKERLNQT
VKEDFSNATELADYLVTKNIPFRTAHEIVGKIVLECIQQGHYLLDVPLATYQQHHSSIDA
DIYDYLQPENCLKRRQSYGSTGQSSVKQQLDVAKQLLSQ
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgagcaataaagcttggggcggtagatttgaagtacaacctgaagagtgggttgacgac
tttaacgcatccattacttttgaccaaacgctcatagatcaagatatcgaaggcagcatt
gcgcatgcaactatgcttgcgaatcaaggcattattagtcaacaagacagcgaacaaatt
atacaaggactaaaatctattcaacatgattatcatcaagatcaaattcaatttagtgca
tcattagaagatattcatttaaatattgaacatgaattaattaaacgtattggtgatgct
ggtggtaagttgcatactggacgcagtagaaacgatcaagttgcaacagatatgcacttg
tacactaagaaacaagtgcaagatatcatcgcattaattaagtcgttacaaagtgtaatt
gtagacatcgcttccaataatgttgatacaattatgcctggttatactcatttacagcgt
gcacagccaatttcatttgcacatcatattatgacttatttttggatgttacaacgagac
caacaacgatttgaagatagtttaaaacgaatcgatattaatcctttaggtgcagcagcc
ttaagtggtaccacataccctatcgatagacacgagacaacagcattgttgaactttggc
agtctctatgagaatagcctagatgctgttagtgacagagactatattattgaaacattg
cataatatttctttaacgatggttcacttatcacgctttgcagaggaaattattttctgg
tccacagacgaagctaaattcattacattatcagatgcattttcaactggctcatctatt
atgccacaaaagaaaaatcctgatatggcagaattaattagaggtaaagttggtcgaacg
actggtcatttaatgagcatgcttatgactttaaaaggattacctctagcatataacaaa
gatatgcaggaagataaagaaggtttattcgatgctgtccatacaattaaaggttcttta
cgtattttcgaaggtatgattcaaacgatgacaattaataaagaacgactcaatcaaact
gttaaagaagatttttcaaatgcaacggaactagcagattatttagtaactaaaaatatt
ccatttagaactgcacatgaaattgtaggaaaaatcgtcttagaatgtatacaacaaggt
cattatttattagatgttcctttagcaacatatcaacaacatcattctagtatcgatgcc
gatatttacgattatttgcagcctgaaaattgcttgaaacgacgtcaaagttacgggtca
acggggcaatcatcggtcaaacaacaacttgatgttgctaaacaattactatcacaataa

DBGET integrated database retrieval system