KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_1037Help
Entry
SAHV_1037         CDS       T00588                                 

Definition
hypothetical protein
Orthology
K08680  
2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [EC:4.2.99.20]
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:saw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    SAHV_1037
Enzymes [BR:saw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     SAHV_1037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1095891..1096694
Genome map
AA seq 267 aa AA seqDB search
MTHYKYYEANVETNQVLVLLHGFLSDSRTYYNHIDKYTDICHVITIDLPGHGEDQSSMDE
TWNFDYITTLLDRILDKYKDKSITLFGYSMGGRVALYYAINGHIPISNLILESTSPGIKE
EANQLERRLVDDARAKVLDIAGIELFVNDWEKLPLFQSQLELPVEIQHQIRLQRLSQSPQ
KMAKALRDYGTGQMPNLWPRLKEIKVPTLILAGEYDEKFVQIAKKMANLIPNSKCKLISA
TGHTIHVEDSDEFDTMILGFLKEEQND
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgacacattataaatactatgaagcaaacgttgagaccaatcaagttttagtattactg
catggttttcttagcgacagtcgtacttattataatcacatcgataaatatactgatatc
tgtcatgtcatcactatagacttaccaggccatggcgaagatcagtcttcaatggatgaa
acgtggaattttgattatattacgacgttgttagaccgaattttagataaatataaagat
aaatcaataacattgtttggatattcaatgggtgggcgtgttgcattatattatgcaatt
aatggtcacatccctatatctaatttgatattagaaagtacgtcaccaggtattaaagaa
gaagcaaatcaattggaacgccgtcttgttgatgatgcacgtgctaaagtattagacata
gcaggtattgaattatttgttaatgattgggaaaagttgccattatttcaatcgcaacta
gaattaccagttgaaatacaacatcaaataagactacaacgattgtctcaatcgccacag
aaaatggccaaagcattaagagattatggtacaggtcaaatgccaaacttatggccgcgc
ctgaaagaaattaaagtaccaacattaatattagctggagaatatgatgaaaaatttgta
cagattgcgaaaaaaatggcaaatttaattcctaatagtaaatgtaaattaatttctgct
acaggtcatacaattcatgtggaagatagtgatgaatttgatacaatgatattaggattt
ttaaaggaggagcaaaatgactaa

DBGET integrated database retrieval system