KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_1295Help
Entry
SAHV_1295         CDS       T00588                                 

Gene name
bsaA
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:saw00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:saw00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1381181..1381657)
Genome map
AA seq 158 aa AA seqDB search
METIYDFVVETNKGVTYKLDAYKGDVMLIVNTASECGFTSQFEGLQSLYEKYKDQGFVIL
GFPCNQFGGQEPGSGEEAAQNCKLNYGVTFPMHQKIDVKGEHQLPLFRYLTAAQHGFFNE
KIKWNFTKFLVDREGNVVKRFAPQKKPVQIEREIEKLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggagacaatttatgattttgtagtagaaacaaataaaggtgttacttacaaattagat
gcatataagggtgacgttatgctaattgttaatacagctagcgaatgtggctttacttca
caatttgaaggtttgcaatcattatacgagaaatacaaagatcaagggtttgtaattcta
ggtttcccttgtaatcaatttggtggtcaagaacctggatcaggcgaagaagcagctcaa
aactgtaaattaaactatggtgttaccttccctatgcatcaaaaaatagacgtaaaaggg
gaacatcaattacctttatttagatatttgactgcggcacaacacggattctttaatgag
aaaatcaaatggaatttcactaagtttttagtggatcgcgaaggtaacgttgttaaacga
tttgcacctcaaaaaaaacctgttcaaatcgaaagagaaatagaaaaattattataa

DBGET integrated database retrieval system