KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_1817Help
Entry
SAHV_1817         CDS       T00588                                 

Gene name
hemY
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:saw00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1963062..1964462)
Genome map
AA seq 466 aa AA seqDB search
MTKSVAIIGAGITGLSSAYFLKQQDPNIDVTIFEASNRPGGKIQSYRKDGYMIELGPESY
LGRKTIMTELAKDIGLEQDIVTNTTGQSYIFAKNKLYPIPGGSIMGIPTDIKPFVTTKLI
SPLGKLRAGLDLIKKPIQMQDGDISVGAFFRARLGNEVLENLIEPLMGGIYGTDIDKLSL
MSTFPNFKEKEEAFGSLIKGMKDEKNKRLKQRQLYPGAPKGQFKQFKHGLSSFIEALEQD
VKNKGVTIRYNTSVDDIITSQKQYKIVYSNQQEDVFDGVLVTTPHQVFLNWFGQDPAFDY
FKTMDSTTVATVVLAFDEKDIENTYDGTGFVIARTSDTDITACTWTSKKWPFTTPEGKVL
IRAYVGKPGDTVVDDHTDNELVSIVRRDLSQMMTFKGDPEFTIVNRLPKSMPQYHVGHIQ
QIRQIQAHIKQTYPRLRVTGASFEAVGLPDCITQGKVAAEEVIAEL
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
gtgactaaatcagtggctattataggagcggggataacaggtttatcaagtgcatatttt
ttaaaacagcaagatcctaatattgatgtaaccatctttgaagcatcgaatcgtccgggg
ggaaagattcaatcgtatcgtaaagatggttatatgattgaactagggcctgaatcttat
ttaggtagaaaaacgattatgacagaattagcgaaagatattggattagaacaagatatt
gttacaaatacgactggacaatcatatatttttgcgaaaaataaattatatccgattcca
ggtggttcaattatgggtattccaacagatattaaaccatttgttactacaaaattaata
tcgccacttggtaaattaagagcaggattagatttaatcaaaaagcctatacaaatgcaa
gatggtgacatttctgttggtgcatttttcagagcaagattaggtaatgaggtacttgag
aacttaattgagcctttaatgggtggtatttatggtaccgatattgataaattaagtttg
atgagtacgtttcctaattttaaagaaaaagaagaggcattcggaagtctgataaaaggt
atgaaggatgagaaaaataagcgtctgaaacaaagacaattatatcctggcgcaccaaaa
ggacaattcaaacaatttaagcatggtttaagctcatttattgaagcattagaacaagat
gtgaaaaataaaggtgtgacaatacgctacaatacgtcagtggatgatattattacatct
caaaagcaatataaaattgtttacagtaatcaacaagaagatgtattcgatggggtatta
gtgacaacaccgcatcaagtctttttgaattggttcggacaagatccagcatttgattac
tttaaaacgatggatagtacgactgttgcaactgttgtattggcatttgatgaaaaagac
attgaaaatacttatgatggtactggcttcgtgattgcgagaacgagtgatacagacatt
accgcatgtacttggacatcgaaaaaatggccatttactacaccagaaggtaaggttttg
attcgtgcgtatgtaggtaaaccaggtgatactgtggttgatgatcatacagataatgaa
ttagtatcgattgtacgtagagatttaagtcaaatgatgacatttaaaggtgatcctgaa
tttacaattgtcaatcgtttgccgaaaagtatgccacagtaccatgtcggtcatattcaa
caaattagacagattcaagcacatattaaacaaacatatccacgacttagagtaactggt
gcatcttttgaagcggttggactacctgattgtattacacaaggtaaagttgctgctgaa
gaagtaatcgcagagttgtaa

DBGET integrated database retrieval system