KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_1992Help
Entry
SAHV_1992         CDS       T00588                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:saw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAHV_1992
  Amino acid metabolism
   00300 Lysine biosynthesis
    SAHV_1992
Enzymes [BR:saw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SAHV_1992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2131225..2132379
Genome map
AA seq 384 aa AA seqDB search
MTTFSEKEKIQLLADIVELQTENNNEIDVCNYLKDLFDKYDIKSEILKVNEHRANIVAEI
GNGSPILALSGHMDVVDAGNQDNWTYPPFQLTEKAGKLYGRGTTDMKGGLMALVITLIEL
KEQNQLPQGTIRLLATAGEEKEQEGAKLLADKGYLDDVDGLIIAEPTGSGIYYAHKGSMS
CKVTATGKAVHSSVPFIGDNAIDTLLEFYNQFKEKYSELKKHDTKHELDVAPMFKSLIGK
EISEEDANYASGLTAVCSIINGGKQFNSVPDEASLEFNVRPVPEYDNDFIESFFQNIIND
VDSNKLSLDIPSNHRPVTSDKNSKLITTIKDVASSYVEQDEIFVSALVGATDASSFLGDN
KDNVDLAIFGPGNPLMAHQIDEYY
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgacaacttttagtgaaaaagaaaaaattcaattactagcagatattgttgaactacaa
actgaaaataataatgaaatagacgtttgtaattatttaaaagatttattcgacaagtac
gatattaaatctgaaattttgaaagttaatgaacaccgcgccaatatcgttgcagaaatc
ggtaacggctcacctatactcgcattgagtggtcatatggatgttgttgatgcaggaaat
caagataattggacttatcccccttttcaactcacagaaaaagctggcaaattatacggt
cgaggcacaacggatatgaaaggcggtctgatggctttggtcatcacactcattgaatta
aaagaacaaaatcaattgcctcaaggaacgataagattactagctactgctggcgaagag
aaagaacaagaaggtgccaaattattggctgataaaggctatttagacgatgtagatggc
ttaattattgctgaaccaactggatctggaatttattatgcacataaagggtctatgtca
tgtaaagtaactgcaactggcaaagctgtccatagctcagttccatttattggtgacaat
gcaattgatacactgcttgaattttataatcaatttaaagaaaaatattcagagcttaaa
aaacatgatactaaacatgaattagatgttgcacccatgttcaaatcattgataggaaaa
gaaatttctgaagaggatgcaaattatgcatctggtcttacagctgtatgttcgattata
aatggcggcaaacaatttaactctgtaccagatgaagcttcacttgaatttaacgtaaga
ccagttcctgagtatgataacgactttatagaatcgtttttccaaaatatcattaatgat
gtggatagcaataagctttcactcgatattccaagcaatcaccgacctgtaacaagcgat
aaaaatagcaaattaattactacgattaaagatgtagcttctagttatgtagaacaagac
gaaatatttgtttcagcgcttgtaggtgcaacagatgcctctagtttcttaggagataat
aaggacaatgttgatttagccatttttggaccaggtaatccattaatggcacatcaaatc
gatgaatattattga

DBGET integrated database retrieval system