KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_2148Help
Entry
SAHV_2148         CDS       T00588                                 

Gene name
arg
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
saw00220  Arginine biosynthesis
saw00330  Arginine and proline metabolism
saw01100  Metabolic pathways
saw01110  Biosynthesis of secondary metabolites
saw01130  Biosynthesis of antibiotics
saw01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:saw00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    SAHV_2148 (arg)
   00330 Arginine and proline metabolism
    SAHV_2148 (arg)
Enzymes [BR:saw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     SAHV_2148 (arg)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: BAF79031
Position
complement(2300540..2301448)
Genome map
AA seq 302 aa AA seqDB search
MTKTKAIDIIGAPSTFGQRKLGVDLGPTAIRYAGLISRLKQLDLDVYDKGDIKVPAVNIE
KFHSEQKGLRNYDEIIDVNQKLNKEVSASIENNRFPLVLGGDHSIAVGSVSAISKHYNNL
GVIWYDAHGDLNIPEESPSGNIHGMPLRILTGEGPKELLELNSNVIKPENIVLIGMRDLD
KGERQFIKDHNIKTFTMSDIDKLGIKEVIENTIEYLKSRNVDGVHLSLDVDALDPLETPG
TGTRVLGGLSYRESHFALELLHQSHLISSMDLVEVNPLIDSNNHTAEQAVSLVGTFFGET
LL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagacaaaagcaattgatattataggtgcaccatcaacatttggacaaagaaaa
ttaggtgttgatttaggaccaacagcaattagatatgctggattaatttcaagattaaag
caattagaccttgatgtatatgacaagggggatattaaggtacctgctgtgaacattgaa
aaatttcatagtgaacaaaaaggattaagaaattatgatgaaattatagatgttaatcaa
aaattaaataaagaggtttcagcatcaattgaaaataacagatttcctctagttcttggt
ggtgatcattctattgcggtaggttcagtatcagcaataagtaaacattataataattta
ggtgttatttggtatgatgcacatggtgatttaaatatacctgaagagtcaccaagtgga
aatattcatggtatgcctctaaggattttgacaggcgaaggtcccaaagaacttttagaa
ttaaatagtaatgtaatcaagccagaaaacatcgtactaattggtatgagagatttagat
aaaggtgaaagacaatttatcaaagatcataatattaaaacatttactatgtcagatatt
gataaattagggataaaggaagtaattgaaaatacaatagaatatttgaagtcacgcaat
gttgatggcgttcatttatctttagatgttgatgctttagatccgcttgaaacgccaggc
actggtactagagttttgggtggtcttagttatagagaaagccattttgcattggaatta
ctgcatcaatcacatttaatttcctcaatggatttagttgaagtaaatccattgattgac
agtaataatcatactgctgaacaagcggtttcattagttggaacattttttggtgaaact
ttattataa

DBGET integrated database retrieval system