KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_2593Help
Entry
SAHV_2593         CDS       T00588                                 

Definition
(GenBank) acetate-CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
saw00010  Glycolysis / Gluconeogenesis
saw00620  Pyruvate metabolism
saw00640  Propanoate metabolism
saw00680  Methane metabolism
saw01100  Metabolic pathways
saw01110  Biosynthesis of secondary metabolites
saw01120  Microbial metabolism in diverse environments
saw01130  Biosynthesis of antibiotics
saw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:saw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAHV_2593
   00620 Pyruvate metabolism
    SAHV_2593
   00640 Propanoate metabolism
    SAHV_2593
  Energy metabolism
   00680 Methane metabolism
    SAHV_2593
Enzymes [BR:saw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SAHV_2593
Lipid biosynthesis proteins [BR:saw01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SAHV_2593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C Atu4866
Motif
Other DBs
NCBI-ProteinID: BAF79476
Position
complement(2756625..2758244)
Genome map
AA seq 539 aa AA seqDB search
MYERKLVMQKSALFAPEKYNIISEIEKYSHIPDKKAILYHNTEGEDISVTYQQLIEQSNK
VGNVLASHGLSKGDKVLIMMPRSIATYELYIAALKLGVAIIPCSEMLRTKDLQYRITHGE
INAVIALEPFTVEFEKIKEYDALTKFVIAGQKDGWISLEAEKENASNKLEMADTTRDDMA
ILSYTSGTTGNPKAVTHCHGWGFAHLQMAPKHWLCINEDDLVWATAAPGWQKWVWSPFLS
VLGSGATAFVFNGRFSPETYLELLQKYQINVLCCTPTEYRMMAKLQNLNDYDLTHLHSAV
SAGEPLNREVVEQFKKYFNLTVRDGYGQTESTLLIGFLKDTPQRIGSMGKGIPGSSVTVV
DDEGNSVPANTKGNIAVPLDLPALFKGYYKEPERTAKAQTGKYYITGDLAHVDDDGYFWF
EGRRDDIIISSGYTIGPFEVEDALTNHPAVKECAVVAKPHDIRGNIVKAFVILQDHTAGD
DTLVKELQQFVKNEVAPYKYPREIEFVDDLPKTNSGKIRRVELRDSEIEKWQQQKDSNQ
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaaaggaagttagttatgcaaaagtcagctctattcgcgcctgaaaaatataac
attatttcggaaatcgaaaaatatagccacataccagataaaaaggcaattttatatcat
aatactgaaggcgaagatatatcagtcacttaccaacagctcattgaacagtctaataaa
gtaggtaatgttttagcatcgcacggtttatctaaaggcgataaagtactcattatgatg
ccacgatctattgcgacgtatgaattatatattgctgctttaaaattaggtgttgcaatc
attccatgttctgaaatgctaagaactaaagatttacaataccgtatcacgcacggtgaa
ataaatgcagttattgcactagagccattcacagttgaatttgaaaaaattaaagaatat
gatgcgttaactaaatttgttattgccggtcaaaaagatggatggatttcacttgaagct
gaaaaagaaaacgcaagtaacaaactagaaatggcagatacgacgcgtgatgatatggcg
attctgtcatatacatctggtacaactggcaatcctaaagccgttacacattgtcatgga
tggggatttgcacatttacaaatggcaccaaaacattggttatgtattaatgaagatgac
ttagtttgggcaacagcagcaccaggttggcaaaaatgggtatggagtcctttcttatct
gtattaggttcaggtgcaactgcttttgtatttaatggaaggttcagtcctgaaacatac
ttagaattgcttcaaaaatatcaaattaatgttttatgttgtacaccgacagaatatcgt
atgatggctaaattacagaacttaaatgattatgacttaacgcatttacatagtgccgtt
tctgcaggtgagccactaaatcgagaagtagttgaacaattcaagaaatactttaattta
actgtaagagatggatatggccagactgaaagtaccttgcttataggctttttaaaagat
acaccacagaggattggatcaatgggtaaaggcattccaggtagttcggtcactgtagta
gatgatgaggggaatagcgtacctgctaatacgaaagggaatattgcagtaccacttgat
ttgccagcacttttcaaagggtattataaagagccagaacgtacggcgaaagcgcaaaca
ggtaaatactacatcactggtgacttagctcatgtagatgatgatggttatttctggttt
gaaggacgtcgagatgacattattattagttcaggctatacgattgggccttttgaagtt
gaagatgcgttaacgaatcatccagccgttaaagaatgtgctgtagtagcaaaacctcat
gatatacgaggaaatattgttaaagcattcgttattttacaggaccatactgcgggtgat
gatacgttagttaaagaactacaacaatttgttaaaaatgaagttgcaccatataaatat
ccgagagagattgaattcgttgacgacttaccaaaaacaaactcaggtaaaattcgtcgt
gttgaactacgagattctgaaatagaaaaatggcaacaacaaaaagatagcaatcaataa

DBGET integrated database retrieval system