KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_2611Help
Entry
SAHV_2611         CDS       T00588                                 

Gene name
phoB
Definition
alkaline phosphatase III precursor
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:saw00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:saw00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:saw02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2780364..2781788
Genome map
AA seq 474 aa AA seqDB search
MLSVKKATKFAVANLIIVSTVFSSVTPAIAQSDKSSKDESFAVGNTKNPKNVIFLVGDGM
GPSFNTAYRYYKNDSHAKEMTPTAFDSYLKGTNRTYSNDPKQNITDSAAGGTAFSSGHKT
YNGAIGVDSNKQKVKTVLERAKEKGKSTGLVSTAELTDATPAAYAAHVTSRDDKNEIAKQ
FYKDKINGKHKVDVLLGGGAKYFGKSNGNLDKKFKKDGYDLATNSKDLSKSDKDKVLGLF
ADKNMPLAIDASKDEPSLADMQQSALSKLERNKKGFFLMVEGASIDKSAHSNDITGVMSE
MEGFEKAFDDAIQYAKKHKDTLVVATADHSTGGLTIGKDKGYEWNPQPIKSMKHSGSYMT
EKMAKGEDPEKVINEGYGFEFSQDDMKKVKKENKKLQKLLKKEKDEKSADVEKQTKALQH
AIQKPVNDKSYTGWTSDGHTGEDVNTYAYGPRSESFSGNIENTESAKIIFDIFK
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgttatcagttaaaaaagccacaaaatttgcagttgctaaccttattatcgtgtcaaca
gttttcagttctgtcacacctgcaattgcgcaatccgataaaagttctaaagatgaaagt
ttcgcggttggtaatactaaaaatccaaaaaatgttatctttttagttggcgatggcatg
ggtccatcatttaacacagcttatcgttattataaaaatgattcgcatgccaaagaaatg
acccctactgcttttgattcatatttaaaaggcacaaatcgtacatattcaaatgaccca
aaacagaatattactgattctgcagctggcggaacagcctttagttctggccataagaca
tataatggtgccatcggtgttgacagtaacaagcagaaagtaaagacagtgcttgaacgt
gcaaaagaaaaaggtaagtcgactggtcttgtttcaacagctgaattaacagatgcaaca
ccagcagcatatgctgcacacgtgacttctagagatgataaaaacgaaatcgctaaacaa
ttttataaagataaaatcaacggaaagcataaagttgatgttttattaggcggcggcgct
aaatatttcggtaaaagtaatggcaatttagataaaaaattcaaaaaagatggttacgac
cttgccacgaacagtaaggatttatcaaaatctgataaagataaagttcttggtttgttt
gcagataaaaatatgccacttgcaatagatgcttctaaagacgaaccatcattagctgat
atgcaacaaagtgcacttagtaagcttgagcgtaataaaaaaggtttctttttaatggtc
gaaggtgcttctatagataaatcagcgcattccaacgatattacaggcgttatgtctgaa
atggaaggttttgaaaaagcattcgatgacgccattcaatatgctaagaaacataaagat
acacttgtcgttgcaacagcagatcactctactggtggtctaacaattggtaaagataaa
ggatacgaatggaatcctcaaccgattaaatcgatgaaacactctggatcatatatgaca
gaaaaaatggctaaaggtgaagaccctgaaaaagttattaatgaaggttatggctttgaa
ttttcacaagatgatatgaaaaaggttaaaaaagagaataaaaagttgcaaaaattactt
aaaaaagaaaaagacgaaaaatctgcagatgtagaaaaacaaacaaaagccttacaacac
gcaattcagaagccagtaaatgataaatcttatacagggtggacttccgatggacataca
ggcgaggatgttaatacctacgcttacggacctagatcagaatcatttagtggtaatatc
gaaaatacagaaagcgcaaaaataatatttgatatattcaagtaa

DBGET integrated database retrieval system