KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MSSA): USA300HOU_0059Help
Entry
USA300HOU_0059    CDS       T00629                                 

Gene name
adhC
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MSSA)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sax00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    USA300HOU_0059 (adhC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    USA300HOU_0059 (adhC)
  Lipid metabolism
   00071 Fatty acid degradation
    USA300HOU_0059 (adhC)
  Amino acid metabolism
   00350 Tyrosine metabolism
    USA300HOU_0059 (adhC)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    USA300HOU_0059 (adhC)
   00626 Naphthalene degradation
    USA300HOU_0059 (adhC)
Enzymes [BR:sax01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     USA300HOU_0059 (adhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
64071..65168
Genome map
AA seq 365 aa AA seqDB search
MGAKKPYKESKPLKIEYLELDNPSEHEVLIKIHAAGLCHSDLSVINGNRPRPLPMALGHE
ASGEVIKVGKAVTRVSEGDHVVCTFIPSCGKCIPCKEGRPALCENGAISNEKGEMLEGGM
RLSNDEGKVYHHLGISGFAEYSVVSENSIVKIDKKIPFERAAAFGCAIITGIGAVVNTAQ
IRSGSNVAVVGLGGIGLNAIIGAKLAGANEIIALDINEDKFELAKQFGATATFNSSDKDI
DEQIKEYIPGGVEYAFETAGVVPAMKVAYQITKRGGTTVTTGLPNPKDNFSFPQVTLAAE
ERTIKGSYVGSCVPDRDIPRFVNLYNQGRLNIDSLISEVITLDEINEGFDRLSNGEVGRI
IMKMH
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgggggctaaaaagccctataaagaatctaaacctttaaaaattgaatacttagaactt
gataatcctagcgaacacgaagtattaattaaaattcatgcagctggattatgtcactct
gatttgtcagtaattaatggtaacagacctagacctttacctatggcacttggtcatgaa
gcttccggtgaagtaattaaagttggaaaagctgttacaagagttagcgaaggagatcat
gtggtatgcacatttattcccagttgtggaaaatgtatcccatgtaaagaaggacgtcct
gcattatgtgaaaacggagcaatatctaatgaaaaaggcgaaatgttagagggagggatg
cgtttatctaatgatgaaggaaaagtatatcatcacttggggatatcaggttttgctgaa
tattctgttgtctctgaaaactctatagttaaaattgataaaaaaataccttttgaacgt
gcagctgcatttggttgtgctattatcacaggtatcggtgctgtggtgaatacagcccaa
attcgttctggtagtaatgtagcggttgttggtttaggaggtattggattgaatgctatt
attggagctaaactagcgggagccaatgaaattattgctttagatattaacgaagataaa
tttgaattagcaaagcaatttggggctacagcaacatttaattcaagcgataaagatatc
gatgagcaaattaaagaatatattcctggcggagtagaatatgcttttgaaacagcgggt
gtagtgccagctatgaaagttgcttatcagattactaaacgaggggggacaactgtaaca
acaggactgcctaatcctaaagataatttttctttccctcaagttactttagcggctgaa
gaacgtaccattaaaggatcatatgtaggaagttgtgtacctgacagagatataccaagg
ttcgttaatctatacaaccaaggacgtttaaatattgattcactcatcagtgaggttatc
actttagatgaaattaatgagggatttgatcgtttgtctaatggtgaagtaggtagaatt
ataatgaagatgcattga

  All links  
No link information was found.   
DBGET integrated database retrieval system