KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MSSA): USA300HOU_0508Help
Entry
USA300HOU_0508    CDS       T00629                                 

Gene name
sul
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MSSA)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sax00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    USA300HOU_0508 (sul)
Enzymes [BR:sax01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     USA300HOU_0508 (sul)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
551887..552690
Genome map
AA seq 267 aa AA seqDB search
MTKTKIMGILNVTPDSFSDGGKFNNVESAINRVKAMIDEGADIIDVGGVSTRPGHEMVSL
EEEMNRVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDMINDQWAGLYDHRMFQIVAK
YDAEIILMHNGNGNRDEPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGIGFAKTRNEEA
EVMARLDELVATEYPVLLATSRKRFTKEMMGYDTTPVERDEVTAATTAYGIMKGVRAVRV
HNVELNAKLAKGIDFLKENENARHNLS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaacaaaaattatgggcatattaaacgtcacacctgattcattctcagatggt
ggaaaatttaataatgttgaatcagctataaatagagtgaaagccatgatagatgaaggt
gctgacattatagatgttggaggtgtttcaacgagacccggtcatgaaatggtttcatta
gaagaagagatgaacagagtattacctgttgttgaagctattgtcggttttgatgtaaaa
atttcagtcgatacatttcgaagtgaggttgctgaagcatgtttaaaattaggcgttgat
atgattaatgatcaatgggcgggtctgtatgatcatcgtatgttccaaattgtagctaaa
tatgacgcggaaattattttaatgcataatggaaatggtaatcgtgatgaaccggttgtc
gaagaaatgttaacatctttgttagcacaagcacatcaagctaaaatagctggtatacct
tcaaataaaatttggctagatccaggtataggtttcgctaaaactagaaatgaagaagcc
gaagttatggcaagactggatgaacttgttgcaacagaatatccagttttattagcgaca
agccggaaacgtttcactaaagagatgatgggttatgatacaacaccggttgaaagagat
gaagtaactgcagctacgactgcatatggtattatgaaaggcgttagagcagtacgcgtt
cataatgtcgagttgaatgctaaattagctaaaggtatagattttttaaaggagaatgaa
aatgcaagacacaatctttcttaa

DBGET integrated database retrieval system