KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MSSA): USA300HOU_0521Help
Entry
USA300HOU_0521    CDS       T00629                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MSSA)
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:sax00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
575123..576577
Genome map
AA seq 484 aa AA seqDB search
MSDRIRVRYAPSPTGYLHIGNARTALFNYLYAKHYNGDFVIRIEDTDKKRNLEDGETSQF
DNLKWLGLDWDESVDKDNGYGPYRQSERQHIYQPLIDQLLAEDKAYKCYMTEEELEAERE
AQIARGEMPRYGGQHAHLTEEQRQQFEAEGRQPSIRFRVPQNQTYSFDDMVKGNISFDSN
GIGDWVIVKKDGIPTYNFAVAIDDHYMQISDVIRGDDHISNTPKQIMIYEAFGWEPPRFG
HMSLIVNEERKKLSKRDGQILQFIEQYRDLGYLPEALFNFIALLGWSPEGEEEIFSKEEF
IKIFDEKRLSKSPAFFDKQKLAWVNNQYMKQKDTETVFQLALPHLIKANLIPEVPSEEDL
SWGRKLIALYQKEMSYAGEIVPLSEMFFKEMPALGEEEQQVINGEQVPELMTHLFSKLEA
LEPFEAAEIKKTIKEVQKETGIKGKQLFMPIRVAVTGQMHGPELPNTIEVLGKEKVLNRL
KQYK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatcgtataagagtaagatatgcaccaagtccaactgggtatcttcatattggt
aatgcaagaacagcattattcaattacttgtatgctaaacattacaacggagattttgtg
attcgaattgaagatactgataaaaaacgtaatttagaagatggagaaacatcacaattt
gataatcttaaatggttaggattagattgggatgagtctgtagataaagacaatggctac
ggaccatatcgtcaatctgaacgtcaacatatctaccaaccattaatagatcagttacta
gcagaagataaagcatataaatgctatatgacagaagaagaattagaagctgaacgtgaa
gcgcaaatcgctcgtggtgaaatgcctcgctatggtggtcaacatgcgcatttgactgaa
gaacaacgtcaacaatttgaagcagaaggacgccaaccatcaattcgtttccgagtacct
caaaaccaaacgtattcatttgatgatatggtaaaaggaaatatttcatttgattcaaat
ggtattggtgactgggttatcgtaaaaaaagatggcattccaacgtacaattttgcagta
gctatagatgatcattacatgcaaatttcagatgtaattcgtggtgatgatcatatttca
aacacgcctaaacaaattatgatttatgaagcatttggctgggagccacctcgttttggt
catatgtcattaattgttaatgaagaacgtaaaaagttaagtaaacgtgatgggcaaatt
ttacaatttattgagcaatatcgtgacttaggttatttacctgaagcgttatttaatttt
attgcgttattaggttggtctcctgaaggtgaagaagaaatcttttctaaagaagaattt
atcaaaatctttgatgaaaagcgtttgtcaaaatcaccagcatttttcgataagcaaaaa
ttagcatgggttaataaccaatatatgaaacaaaaagatactgaaacagtattccaatta
gcattacctcatttaattaaagcaaatttgattcctgaggtgccgtcagaagaggattta
tcttggggacgcaaattaattgcgctttatcaaaaagaaatgagttatgccggtgaaatt
gtacctttatcagaaatgttctttaaagaaatgccagctcttggtgaagaagaacaacaa
gtgattaatggagagcaagtaccagagttaatgacgcacttattcagtaaattagaagca
cttgaaccatttgaagcggctgaaattaaaaagacaattaaagaagttcaaaaagaaaca
ggaataaaaggcaagcaattatttatgcctattcgtgttgctgtaacaggccaaatgcat
ggtcctgaattaccaaatacaattgaagtacttggtaaagaaaaagtgctaaaccgttta
aaacaatataagtaa

DBGET integrated database retrieval system