KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MSSA): USA300HOU_0565Help
Entry
USA300HOU_0565    CDS       T00629                                 

Definition
glucose-6-phosphate isomerase (EC:5.3.1.9)
Orthology
K08094  
6-phospho-3-hexuloisomerase [EC:5.3.1.27]
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MSSA)
Pathway
Pentose phosphate pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Formaldehyde assimilation, ribulose monophosphate pathway
Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sax00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    USA300HOU_0565
   01230 Biosynthesis of amino acids
    USA300HOU_0565
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    USA300HOU_0565
  Energy metabolism
   00680 Methane metabolism
    USA300HOU_0565
Enzymes [BR:sax01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.27  6-phospho-3-hexuloisomerase
     USA300HOU_0565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
630066..630614
Genome map
AA seq 182 aa AA seqDB search
MAKFSDYQLILDELKMTLSHVEADEFSTFASKILHAEHIFVAGKGRSGFVANSFAMRLNQ
LGKQAHVVGESTTPAIKSNDVFVIISGSGSTEHLRLLADKAKSVGADIVLITTNKDSAIG
NLAGTNIVLPAGTKYDEQGSAQPLGSLFEQASQLFLDSVVMGLMTEMNVTEQTMQQNHAN
LE
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggctaaatttagtgactatcaattaattctagatgaattaaagatgactttgtcacat
gttgaagcggatgagttttcaacttttgcatccaaaatactacatgctgaacatatattt
gtagctggcaaaggacgttcaggattcgtggcgaatagttttgcaatgcgcttaaatcag
ctcggcaaacaggcacatgttgttggagaatcaacgacacctgcgattaagtcgaatgat
gtatttgtaattatctctggttcaggttccacggaacatttaagattattagcagacaaa
gcaaaatcagtaggtgctgacatcgtattaattactacaaataaagattctgcaataggc
aatctagctgggacgaacatcgttttgcctgcaggtacaaaatatgatgaacaaggctcg
gcacaaccattaggaagtttgtttgaacaagcatctcaattatttttagatagtgttgta
atgggattgatgactgaaatgaatgttacggaacaaacgatgcaacaaaatcatgctaat
ttagaataa

DBGET integrated database retrieval system