KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MSSA): USA300HOU_0737Help
Entry
USA300HOU_0737    CDS       T00629                                 

Gene name
pabB
Definition
anthranilate synthase (EC:4.1.3.27)
Orthology
K01665  
para-aminobenzoate synthetase component I [EC:2.6.1.85]
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MSSA)
Pathway
Folate biosynthesis
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sax00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
786675..787835
Genome map
AA seq 386 aa AA seqDB search
MITVRIEYNYRYYLTENEYKQYHIQLKGFIKKYVATKLADVGEVIHFAQAQQRQGRYVSL
YLSYEAAKYFNHAMCTHSLAKDDIYAAAYSFEKAESINSTYEHQTSYVSKYHFSFVESSE
VMMTNIKRVQQAIVEGETYQVNYTARLTDNIYYPISTLYERLTQFSNGNYTALLQTDEIQ
VASISPELFFQKGQFNNVDNVIISKPMKGTMPRGKTEAEDQQYYKTLQTSSKDRAENVMI
VDLLRNDIGRISQSGSIKVYKLFFIEAYKTVFQMTSMVSGTLKNNTDLTQILTSLFPCGS
ITGAPKLNTMKYIKQLESSPRGIYCGAIGLLLPTEDDKMIFNIPIRTIEYKYGQAIYGVG
AGITIDSKPKDEVNEFYAKTKILEML
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtgattactgtgagaatagaatataattatcgctactatttaactgaaaatgaatataag
caataccatattcaattaaagggatttataaagaagtatgttgctactaagttggctgat
gtgggagaagtgatacactttgcacaagcgcagcaacgacaaggtagatatgtctcgtta
tatttaagttacgaagcggcaaagtattttaatcatgctatgtgtacacattcattagct
aaagatgatatttatgcagcagcttatagttttgaaaaagcggaaagcataaattcaaca
tatgaacatcaaacttcttatgtatcaaagtatcatttttcatttgttgaatcttctgag
gttatgatgactaatattaaacgtgtccaacaagcaattgttgaaggcgaaacgtatcaa
gtgaactatacggcgcgcttaacggataacatttattatcctattagtactttatatgaa
cgattaactcaatttagtaatggtaattatactgcgttattacaaactgatgaaatccaa
gtagcgtctatctcaccagaattattttttcaaaaaggacaatttaacaatgtcgataac
gttatcataagcaaaccgatgaaagggacaatgcctagaggtaaaacggaagctgaagat
caacagtattataaaacattgcaaacttcttcgaaagatcgtgcagaaaatgtcatgatt
gttgatttactaagaaacgatatagggagaatatcacagagtggctcaattaaggtgtat
aaactattttttattgaggcatataaaactgtatttcaaatgacttcgatggtaagtgga
actttaaaaaataatacagacttaactcaaattttaacatcgttatttccttgtggttcg
attacaggtgcaccgaaactgaatacaatgaaatatattaaacaattagaaagttcacct
cgtggtatatactgcggagcaattggactattacttccaactgaagatgataaaatgatt
tttaatattccgattcgcactattgagtataaatatggacaagcgatttatggagtcgga
gcaggtattacaattgattctaagccaaaagatgaagtgaatgaattttacgcaaaaacc
aagattttggagatgttataa

DBGET integrated database retrieval system