KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MSSA): USA300HOU_0804Help
Entry
USA300HOU_0804    CDS       T00629                                 

Gene name
tpi
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MSSA)
Pathway
sax00010  Glycolysis / Gluconeogenesis
sax00051  Fructose and mannose metabolism
sax00562  Inositol phosphate metabolism
sax01100  Metabolic pathways
sax01110  Biosynthesis of secondary metabolites
sax01120  Microbial metabolism in diverse environments
sax01130  Biosynthesis of antibiotics
sax01200  Carbon metabolism
sax01230  Biosynthesis of amino acids
Module
sax_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sax_M00002  Glycolysis, core module involving three-carbon compounds
sax_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sax00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    USA300HOU_0804 (tpi)
   00051 Fructose and mannose metabolism
    USA300HOU_0804 (tpi)
   00562 Inositol phosphate metabolism
    USA300HOU_0804 (tpi)
Enzymes [BR:sax01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     USA300HOU_0804 (tpi)
Exosome [BR:sax04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   USA300HOU_0804 (tpi)
  Exosomal proteins of bladder cancer cells
   USA300HOU_0804 (tpi)
  Exosomal proteins of melanoma cells
   USA300HOU_0804 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABX28825
UniProt: A8Z1A2
Structure
PDB: 

Jmol
Position
859756..860517
Genome map
AA seq 253 aa AA seqDB search
MRTPIIAGNWKMNKTVQEAKDFVNALPTLPDSKEVESVICAPAIQLDALTTAVKEGKAQG
LEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFK
HGMTPIICVGETDEERESGKANDVVGEQVKKAVAGLSEDQLKSVVIAYEPIWAIGTGKSS
TSEDANEMCAFVRQTIADLSSKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASL
KVEDFVQLLEGAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaccaattatagctggtaactggaaaatgaacaaaacagtacaagaagcaaaa
gacttcgtcaatgcattaccaacattaccagattcaaaagaagtagaatcagtaatttgt
gcaccagcaattcaattagatgcattaactactgcagttaaagaaggaaaagcacaaggt
ttagaaatcggtgctcaaaatacgtatttcgaagataatggtgcgttcacaggtgaaacg
tctccagttgcattagcagatttaggcgttaaatacgttgttatcggtcattctgaacgt
cgtgaattattccacgaaacagatgaagaaattaacaaaaaagcgcacgctattttcaaa
catggaatgactccaattatatgtgttggtgaaacagacgaagagcgtgaaagtggtaaa
gctaacgatgttgtaggtgagcaagttaagaaagctgttgcaggtttatctgaagatcaa
cttaaatcagttgtaattgcttatgaaccaatctgggcaatcggaactggtaaatcatca
acatctgaagatgcaaatgaaatgtgtgcatttgtacgtcaaactattgctgacttatca
agcaaagaagtatcagaagcaactcgtattcaatatggtggtagtgttaaacctaacaac
attaaagaatacatggcacaaactgatattgatggggcattagtaggtggcgcatcactt
aaagttgaagatttcgtacaattgttagaaggtgcaaaataa

DBGET integrated database retrieval system