KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MSSA): USA300HOU_1147Help
Entry
USA300HOU_1147    CDS       T00629                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MSSA)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:sax00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1220744..1221367
Genome map
AA seq 207 aa AA seqDB search
MDNEKGLLIVLSGPSGVGKGTVRKRIFEDPSTSYKYSISMTTRQMREGEVDGVDYFFKTR
DAFEALIKDDQFIEYAEYVGNYYGTPVQYVKDTMDEGHDVFLEIEVEGAKQVRKKFPDAL
FIFLAPPSLEHLRERLVGRGTESDEKIQSRINEARKEVEMMNLYDYVVVNDEVELAKNRI
QCIVEAEHLKRERVEAKYRKMILEAKK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggataatgaaaaaggattgttaatcgttttatcaggaccatctggagtaggtaaaggt
actgttagaaaacgaatatttgaagatccaagtacatcatataagtattctatttcaatg
acaacacgtcaaatgcgtgaaggtgaagttgatggcgtagattacttttttaaaactagg
gatgcgtttgaagctttaatcaaagatgaccaatttatagaatatgctgaatatgtaggc
aactattatggtacaccagttcaatatgttaaagatacaatggacgaaggtcatgatgta
tttttagaaattgaagtagaaggtgcaaagcaagttagaaagaaatttccagatgcgcta
tttattttcttagcacctccaagtttagaacacttgagagagcgattagtaggtagagga
acagaatctgatgagaaaatacaaagtcgtattaacgaagcgcgtaaagaagttgaaatg
atgaatttatacgattacgttgtagttaatgatgaagtagaacttgcgaagaatagaatt
caatgtattgtagaagctgagcacttaaaaagagagcgcgtagaagctaagtatagaaaa
atgattttggaggctaaaaaataa

DBGET integrated database retrieval system