KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MSSA): USA300HOU_1274Help
Entry
USA300HOU_1274    CDS       T00629                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MSSA)
Pathway
sax00260  Glycine, serine and threonine metabolism
sax00750  Vitamin B6 metabolism
sax01100  Metabolic pathways
sax01110  Biosynthesis of secondary metabolites
sax01120  Microbial metabolism in diverse environments
sax01230  Biosynthesis of amino acids
Module
sax_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sax00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    USA300HOU_1274 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    USA300HOU_1274 (thrC)
Enzymes [BR:sax01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     USA300HOU_1274 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABX29287
Position
1358623..1359684
Genome map
AA seq 353 aa AA seqDB search
MRRWQGLVEEFKAHLPVNENTPKLTLNEGNTPLIHCENMSKILGIDLYVKYEGANPTGSF
KDRGMVMAVTKAKEQGKKIVICASTGNTSASAAAYAARAGLKAIVVIPEGKIALGKLSQA
VMYGAEIVSIEGNFDEALEIVKEIAKSGEIELVNSVNPFRIEGQKTGSFEIVQQLDGEAP
DILAIPVGNAGNITAYWKGFKEYHEAKGSQLPKMFGFQAEGASPIVQNKVIKNPETIATA
IRIGNPASWDKATNALKESNGLIDSVTDDEILEAYQLMTTKEGVFSEPASNASIAGLIKL
HRQGKLPQGKKVVAILTGNGLKDPDTAISLLDNPIKPLPNDKDSIIDYIKGAL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgagaagatggcaaggattagtagaagagtttaaagcacatttaccagtaaatgaaaat
acaccaaaattaacattgaacgagggaaatacaccactcattcattgtgaaaatatgtct
aaaatactaggcatagatttatatgtgaagtatgaaggtgccaatccgacaggttcattt
aaagatcgcggtatggtaatggctgtgacaaaagcaaaagagcaaggtaagaaaattgta
atatgcgcttcgactggaaatacatcagcgtctgcagcagcatatgcagcgagagcaggt
ttaaaagctatcgtcgtaataccagaaggtaaaattgcattaggtaaattgtcgcaagca
gtaatgtatggtgcagaaatcgtttctattgaaggaaactttgatgaagctttagaaatt
gtaaaagaaattgcaaaaagtggcgaaatcgagcttgtaaactctgtcaatccatttaga
atcgaaggacaaaagacaggctcatttgaaattgtacaacaattagacggtgaagcacct
gatattttagcgattcctgtaggtaatgcaggtaatattactgcatattggaaaggcttt
aaagaatatcatgaagctaaaggatcacaattgccgaaaatgtttggcttccaagctgaa
ggcgcatcaccaattgttcaaaataaagtcattaaaaatcctgaaacgattgcaactgct
attcgaattggtaatcctgctagttgggataaggcgactaatgctcttaaagaatcaaat
ggattaatagatagtgttactgatgatgaaattctagaagcatatcagttaatgacaact
aaagaaggtgtctttagtgaaccagcgagtaatgcttctattgcaggtttaattaaattg
catagacaaggtaaattacctcaaggtaaaaaagtagttgctattttaactggtaatgga
ttaaaagatcctgatactgctatttcactactagataatccgataaagccattgccaaat
gataaagatagcattatcgattatattaaaggagctttataa

DBGET integrated database retrieval system