KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MSSA): USA300HOU_1363Help
Entry
USA300HOU_1363    CDS       T00629                                 

Gene name
dfrB
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MSSA)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sax00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    USA300HOU_1363 (dfrB)
   00670 One carbon pool by folate
    USA300HOU_1363 (dfrB)
Enzymes [BR:sax01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     USA300HOU_1363 (dfrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1464677..1465156)
Genome map
AA seq 159 aa AA seqDB search
MTLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRN
VVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRG
DTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgactttatccattctagttgcacatgacttgcaacgagtaattggttttgaaaatcaa
ttaccttggcacctaccaaatgatttgaagcatgttaaaaaattatcaacaggtcatact
ttagtaatgggtcgtaagacatttgaatcgattggtaaaccactaccgaatcgtcgaaat
gttgtacttacttcagatacaagtttcaacgtagagggcgttgatgtaattcactctatt
gaagatatttaccaactaccgggccatgttttcatatttggagggcaaacattatttgaa
gaaatgattgataaagtggacgacatgtatattactgttattgaaggtaaattccgtggt
gatacgttctttccaccttatacatttgaagactgggaagttgcctcttcagttgaaggt
aaactagatgagaaaaatacaattccacatacctttctacatttaattcgtaaaaaataa

DBGET integrated database retrieval system