KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MSSA): USA300HOU_2014Help
Entry
USA300HOU_2014    CDS       T00629                                 

Definition
succinyl-diaminopimelate desuccinylase (EC:3.4.-.-)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MSSA)
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sax00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    USA300HOU_2014
  Amino acid metabolism
   00300 Lysine biosynthesis
    USA300HOU_2014
Enzymes [BR:sax01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     USA300HOU_2014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2131870..2133156
Genome map
AA seq 428 aa AA seqDB search
MFKNKNYVYINIYTTLKGVSLMTTFSEKEKIQLLADIVELQTENNNEIDVCNYLTDLFDK
YDIKSEILKVNEHRANIVAEIGNGSPILALSGHMDVVDAGNQDNWSYPPFQLTEKDGKLY
GRGTTDMKGGLMALVVSLIELKEQNELPHGTIRLLATAGEEKEQEGAKLLADKGYLDDVD
SLIIAEPTGSGIYYAHKGSMSCKVTATGKAVHSSVPFIGDNAIDTLLEFYNLFKEKYSEL
KQQDTKHELDVAPMFKSLIGKEISEEDANYASGLTAVCSIINGGKQFNSVPDEASLEFNV
RPVPEYDNDFIESFFQNIINDVDSNKLSLDIPSNHRPVTSDKNSKLITTIKDVASSYVEQ
DEIFVSALVGATDASSFLGDNKDNVDLAIFGPGNPLMAHQIDEYIEKDMYLKYIDIFKEA
SIQYLKEK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagaataaaaattatgtttatataaatatatatactactttgaaaggtgtgagc
ttaatgacaacttttagtgaaaaagaaaaaattcaattactagcagatattgttgaacta
caaactgaaaataataatgaaatagacgtttgtaattatttaacagatttattcgacaag
tacgatattaaatctgaaattttgaaagttaatgaacaccgcgccaatatcgttgcagaa
atcggtaacggctcacctatactcgcattgagtggtcatatggatgttgttgatgcagga
aatcaagataattggtcatatcccccttttcaactgacagaaaaagatggcaaattatat
ggccgaggcactacagatatgaaaggcggtttaatggctttggtcgtatctctaatcgaa
ttaaaagaacaaaatgaattgcctcatggaacgattagattactggctactgctggcgaa
gagaaagaacaagaaggtgccaaattattagctgataaaggctatttagacgatgtcgat
agcttaattattgctgaaccaactggatctggaatttattatgcacataaggggtctatg
tcatgtaaagtaactgcaactggtaaagctgtccatagctcagttccatttattggtgac
aatgcaattgatacactgcttgaattttataatctatttaaagaaaaatattcagagctt
aaacaacaagatactaaacatgaattagatgttgcgcctatgttcaaatcattgattgga
aaagaaatttctgaagaggatgcaaattatgcatctggtcttacagctgtatgttcgatt
ataaatggcggcaaacaatttaactctgtaccagatgaagcttcacttgaatttaacgta
agaccagttcctgagtatgataacgactttatagaatcgtttttccaaaatatcattaat
gatgtggatagcaataagctttcactcgatattccaagcaatcaccgacctgtaacaagc
gataaaaatagcaaattaattactacgattaaagatgtagcttctagttatgtagaacaa
gacgaaatatttgtttcagcgcttgtaggtgcaacagatgcctctagtttcttaggagat
aataaggacaatgttgatttagccatttttggaccaggtaatccattaatggcacatcaa
atcgatgaatatattgaaaaagatatgtatctgaaatatattgatatttttaaagaggct
tccattcaatatttaaaagaaaaataa

DBGET integrated database retrieval system