KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MSSA): USA300HOU_2154Help
Entry
USA300HOU_2154    CDS       T00629                                 

Gene name
arg
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MSSA)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sax00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    USA300HOU_2154 (arg)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    USA300HOU_2154 (arg)
Enzymes [BR:sax01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     USA300HOU_2154 (arg)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2289678..2290586)
Genome map
AA seq 302 aa AA seqDB search
MTKTKAIDIIGAPSTFGQRKLGVDLGPTAIRYAGLISRLKQLDLDVYDKGDIKVPAVNIE
KFHSEQKGLRNYDEIIDVNQKLNKEVSASIENNRFPLVLGGDHSIAVGSVSAISKHYNNL
GVIWYDAHGDLNIPEESPSGNIHGMPLRILTGEGPKELLELNSNVIKPENIVLIGMRDLD
KGERQFIKDHNIKTFTMSDIDKLGIKEVIENTIEYLKSRNVDGVHLSLDVDALDPLETPG
TGTRVLGGLSYRESHFALELLHQSHLISSMDLVEVNPLIDSNNHTAEQAVSLVGTFFGET
LL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagacaaaagcaattgatattataggtgcaccatcaacatttggacaaagaaaa
ttaggtgttgatttaggaccaacagcaattagatatgctggattaatttcaagattaaag
caattagaccttgatgtatatgacaagggggatattaaggtacctgctgtgaacattgaa
aaatttcatagtgaacaaaaaggattaagaaattatgatgaaattatagatgttaatcaa
aaattaaataaagaggtttcagcatcaattgaaaataacagatttcctctagttcttggt
ggagatcattctattgcggtaggttcagtatcagcaataagtaaacattataataattta
ggtgttatttggtatgatgcacatggtgatttaaatatacctgaagagtcaccaagtgga
aatattcatggtatgcctctaaggattttgacaggcgaaggtcccaaagaacttttagaa
ttaaatagtaatgtaatcaagccagaaaacatcgtactaattggtatgagagatttagat
aaaggtgaaagacaatttatcaaagatcataatattaaaacatttactatgtcagatatt
gataaattggggataaaggaagtaattgaaaatacaatagaatatttgaagtcacgcaat
gttgatggcgttcatttatctttagatgttgatgctttagatccgcttgaaacgccaggc
actggtactagagttttgggtggtcttagttatagagaaagccattttgcattggaatta
ctgcatcaatcacatttaatttcctcaatggatttagttgaagtaaatccattgattgac
agtaataatcatactgctgaacaagcggtttcattagttggaacattttttggtgaaact
ttattataa

DBGET integrated database retrieval system