KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MSSA): USA300HOU_2619Help
Entry
USA300HOU_2619    CDS       T00629                                 

Gene name
gpxA2
Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MSSA)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sax00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    USA300HOU_2619 (gpxA2)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    USA300HOU_2619 (gpxA2)
Enzymes [BR:sax01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     USA300HOU_2619 (gpxA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2764434..2764931)
Genome map
AA seq 165 aa AA seqDB search
MNNRNVYDIEVSDYKGLTYKLEAFRGKVILVVNTATECIYSEQLKKLETLFQKYKDRGFV
VLSFPNNNFDNRQPGSNEEILKISREKFGVTFPVLAKISVNGNDEHPLFTHLKNEQPGIF
GSPIKWNFTKFIIDRQGNVVNRFLPMEDPLDISTNIEILLQESSS
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaataatagaaatgtgtatgatatcgaagtaagtgattataaaggcttaacttataaa
ttagaagcatttagaggtaaagtgattttagttgttaatactgcaacagaatgtatatat
agcgaacaattgaaaaaactagagactttatttcaaaaatataaggatcgtgggtttgta
gtgttgagttttccgaataataattttgacaatcgacaaccaggttctaatgaagaaatc
ttgaaaattagtcgtgagaaatttggtgtaacatttccagtgttagctaaaatatctgtg
aacgggaacgatgaacatccgttatttacgcatttaaagaatgaacaaccaggaatcttt
gggtccccaataaaatggaatttcacaaaatttataatcgatcgacaaggaaatgttgta
aatcgattcttgccaatggaagatccattggatatatcgacaaatatagaaatattattg
caagaatcttcatcttaa

DBGET integrated database retrieval system