KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MSSA): USA300HOU_2679Help
Entry
USA300HOU_2679    CDS       T00629                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MSSA)
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sax01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:sax00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2837986..2839242)
Genome map
AA seq 418 aa AA seqDB search
MPMLNAQQFLNQFSLEAPLDESLYPIIRDICQEVKVHGDKALKMYNLTFDHTKTDHLEIS
HEQIKAAFDTLDEKTKQALQQSYERIKAYQESIKQTNQQLEESVECYEIYHPLESVGIYV
PGGKASYPSTVLMTATLAQVAGVENIVVVTPPQPNGVSQEVLAACYITQVDQVFQVGGAQ
SIAALTYGTETIPKVDKIVGPGNQFVAYAKKYLFGQVGIDQIAGPTEIALIIDETADLDA
IVYDVFAQAEHDELARTYAISEDAQVLKDLESRIAKALPNVDRYDIVSKSIANQHYLIHA
SNFDEACHVMNTIAPEHASIQTVNPQPYIEKVKYVGALFIGHYSPEVIGDYVAGPSHVLP
TNRTARFTNGLSVNDFLTRNTVIHLSKDTFEQIADSAQHIAHVEALYNHQQSILIRQS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
ttgccaatgcttaatgcacaacaatttttaaatcaattttcattagaagcaccattagat
gagtcattgtatccaattattcgcgatatttgtcaggaagttaaagttcatggagataag
gctttgaaaatgtataatctaacattcgatcatacgaaaacagatcatttagaaattagt
catgaacaaattaaagcagcatttgacacattagatgaaaaaacaaaacaagcattacaa
caaagttatgaaagaattaaagcatatcaagaaagtattaaacagacgaatcaacagtta
gaagaatcagtggagtgttatgaaatataccatccactagaaagtgtcggtatttatgtg
cctggtggtaaagcaagttatccttcaacggtattaatgacagcgacgttagcacaagta
gcaggtgtggaaaatattgtcgttgtgacaccacctcaacctaatggtgtgtctcaagaa
gtattagcagcatgctatattacgcaagttgatcaagtatttcaagttggtggtgctcaa
agtattgctgcgttaacttatggcacagaaacgatacctaaagttgataagattgtaggt
ccaggcaatcaatttgttgcatatgccaagaaatatttatttggacaagtaggtattgac
caaatagctggaccaacagaaatagcacttattattgatgaaacagcagatttagatgcc
atcgtatatgatgtttttgcacaagcagaacatgatgaattagcacgtacatatgccatt
agtgaagatgcgcaagtccttaaagatttagaatcacgtattgctaaagcattgcctaat
gtggacagatacgacattgtttctaaaagtatcgctaatcaacactaccttatccatgct
agtaattttgatgaagcatgccatgtcatgaatacaatcgcgcctgaacatgcgtcgatt
caaacagtaaatcctcaaccatatattgaaaaagtgaaatatgtgggtgcattgtttatt
ggacattattcgccagaggtcataggagattacgttgcaggtccaagtcatgtattacct
acaaatagaacagctagatttaccaatgggttatcggtcaatgatttcttaacacggaac
acggtcatccatttatcaaaagatacgtttgaacaaattgctgattcagcacaacatatt
gctcatgttgaagcattatacaatcaccagcagtctattttaatacgtcagtcttag

DBGET integrated database retrieval system