KEGG   Sulfobacillus acidophilus TPY: TPY_0121Help
Entry
TPY_0121          CDS       T01576                                 

Gene name
aceB
Definition
malate synthase A
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:say00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TPY_0121 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TPY_0121 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    TPY_0121 (aceB)
Enzymes [BR:say01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     TPY_0121 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
136478..138046
Genome map
AA seq 522 aa AA seqDB search
MDIKGPTVPGSERILTSDALTFLEDLHRTFNPRRLERLRARQEIQQRIFQGWRPDFRPDT
REIRESEWTVGTIPADLTDRRVEITGPTDRKMVINALNSGARVFMADFEDANSPTWTNLV
LGQMNLIDAIERTITFESPQGETYRLKDQVATLVVRPRGWHLPERHLTVDGEPMAGALVD
FGLYVFHNARRLVERGSAPYLYLPKLENMEEAQLWEDVLGWAEERVGLPFGTMKVTVLIE
TILAAFEMEEILWALRPHIVGLNAGRWDYLFSIIKKFRRQPDVMPADRQQITMTVPFMRA
YTELLVKTCHRRGAYAIGGMAAFIPSRRDPEINRVALAKVEDDKEREARDGFDGTWVAHP
DLVPVATAVFDRVLGPRPHQRDRQRDDVVVTADDLLDFRVPGGTMTEAGLKNNVAVAIQY
LAAWLGGSGAVGLYNLMEDAATAEIARAQVWQWITHGVRLSDGKPVTAQLVERLIQEGLQ
EWGAHWPERDAAVDVFRSVALSSEWVDFLTLPAYDRLLAILH
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
gtggacatcaagggtccaacggttccgggaagcgaacgcattttaacatcggacgcgctc
acctttctggaggatttgcatcggacctttaacccgcggcggttggagcggttacgcgcc
cgtcaggaaatccaacaacgcatctttcagggatggcggccggactttcggccggatacc
cgagagatacgggaatccgaatggacggtgggaaccatacccgccgatctcacggatcgc
cgggtggaaatcaccggtccgacggatcgcaaaatggtgattaatgccctgaattccggg
gctcgggtctttatggccgacttcgaagacgcgaacagtccgacttggaccaacctggtt
ttgggtcagatgaacttaatcgacgcgattgagcggacgattacgttcgaatcgcctcag
ggggagacataccgcttaaaggatcaggtggccaccttggtggtgcgaccgcggggatgg
catttgcccgagcggcatctgacggtagacggtgaaccgatggcgggagccttggtcgat
ttcggactgtacgtgtttcacaacgcccgccgactggtggaacgagggagtgccccctat
ttatatttgccgaaactcgaaaacatggaagaagcccagttgtgggaagacgtgctcggc
tgggcggaggagcgggtggggcttcccttcggcaccatgaaagtgacggtactgattgaa
accattttagcggcttttgaaatggaagagattttgtgggccttgcgtccgcacattgtg
ggattgaatgcgggccgctgggactatctgttcagcattattaagaaattccgtcgccaa
ccggacgtcatgccggccgaccggcagcaaattaccatgaccgtgccgtttatgcgggca
tacaccgaacttttggtcaaaacctgtcatcggcggggggcttatgccattggaggcatg
gcggcatttatcccgagccgccgggatccggagattaaccgcgtggcgctggcgaaagtc
gaggacgacaaagagcgggaagcgcgtgacggattcgacgggacctgggtggcccatccc
gacctcgtgccggttgcgaccgccgtttttgaccgggtgctggggccgcgtcctcatcaa
cgcgaccgccaacgggacgatgtggtcgtaaccgccgacgatttactggatttccgggta
cccggaggcaccatgaccgaggcgggactgaaaaataatgtggcggttgccatccaatac
ttggcggcttggctcggcggttcgggggcggtggggctttataacctgatggaggatgcg
gcgaccgcggaaattgcccgggcccaagtgtggcagtggattacccatggcgtgcggttg
tccgacggtaagccggtgacggcccaactggtggaacggttaattcaagaaggccttcag
gaatggggagcccattggcccgaacgggatgcggcggtggacgttttccggtcggtcgcc
ttgtcgtccgaatgggtcgattttctcacattgccggcctatgaccgcctgttagcgatt
ttacattaa

DBGET integrated database retrieval system