KEGG   Sulfobacillus acidophilus TPY: TPY_0121Help
Entry
TPY_0121          CDS       T01576                                 

Gene name
aceB
Definition
(RefSeq) malate synthase A
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:say00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TPY_0121 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TPY_0121 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    TPY_0121 (aceB)
Enzymes [BR:say01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     TPY_0121 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
136478..138046
Genome map
AA seq 522 aa AA seqDB search
MDIKGPTVPGSERILTSDALTFLEDLHRTFNPRRLERLRARQEIQQRIFQGWRPDFRPDT
REIRESEWTVGTIPADLTDRRVEITGPTDRKMVINALNSGARVFMADFEDANSPTWTNLV
LGQMNLIDAIERTITFESPQGETYRLKDQVATLVVRPRGWHLPERHLTVDGEPMAGALVD
FGLYVFHNARRLVERGSAPYLYLPKLENMEEAQLWEDVLGWAEERVGLPFGTMKVTVLIE
TILAAFEMEEILWALRPHIVGLNAGRWDYLFSIIKKFRRQPDVMPADRQQITMTVPFMRA
YTELLVKTCHRRGAYAIGGMAAFIPSRRDPEINRVALAKVEDDKEREARDGFDGTWVAHP
DLVPVATAVFDRVLGPRPHQRDRQRDDVVVTADDLLDFRVPGGTMTEAGLKNNVAVAIQY
LAAWLGGSGAVGLYNLMEDAATAEIARAQVWQWITHGVRLSDGKPVTAQLVERLIQEGLQ
EWGAHWPERDAAVDVFRSVALSSEWVDFLTLPAYDRLLAILH
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
gtggacatcaagggtccaacggttccgggaagcgaacgcattttaacatcggacgcgctc
acctttctggaggatttgcatcggacctttaacccgcggcggttggagcggttacgcgcc
cgtcaggaaatccaacaacgcatctttcagggatggcggccggactttcggccggatacc
cgagagatacgggaatccgaatggacggtgggaaccatacccgccgatctcacggatcgc
cgggtggaaatcaccggtccgacggatcgcaaaatggtgattaatgccctgaattccggg
gctcgggtctttatggccgacttcgaagacgcgaacagtccgacttggaccaacctggtt
ttgggtcagatgaacttaatcgacgcgattgagcggacgattacgttcgaatcgcctcag
ggggagacataccgcttaaaggatcaggtggccaccttggtggtgcgaccgcggggatgg
catttgcccgagcggcatctgacggtagacggtgaaccgatggcgggagccttggtcgat
ttcggactgtacgtgtttcacaacgcccgccgactggtggaacgagggagtgccccctat
ttatatttgccgaaactcgaaaacatggaagaagcccagttgtgggaagacgtgctcggc
tgggcggaggagcgggtggggcttcccttcggcaccatgaaagtgacggtactgattgaa
accattttagcggcttttgaaatggaagagattttgtgggccttgcgtccgcacattgtg
ggattgaatgcgggccgctgggactatctgttcagcattattaagaaattccgtcgccaa
ccggacgtcatgccggccgaccggcagcaaattaccatgaccgtgccgtttatgcgggca
tacaccgaacttttggtcaaaacctgtcatcggcggggggcttatgccattggaggcatg
gcggcatttatcccgagccgccgggatccggagattaaccgcgtggcgctggcgaaagtc
gaggacgacaaagagcgggaagcgcgtgacggattcgacgggacctgggtggcccatccc
gacctcgtgccggttgcgaccgccgtttttgaccgggtgctggggccgcgtcctcatcaa
cgcgaccgccaacgggacgatgtggtcgtaaccgccgacgatttactggatttccgggta
cccggaggcaccatgaccgaggcgggactgaaaaataatgtggcggttgccatccaatac
ttggcggcttggctcggcggttcgggggcggtggggctttataacctgatggaggatgcg
gcgaccgcggaaattgcccgggcccaagtgtggcagtggattacccatggcgtgcggttg
tccgacggtaagccggtgacggcccaactggtggaacggttaattcaagaaggccttcag
gaatggggagcccattggcccgaacgggatgcggcggtggacgttttccggtcggtcgcc
ttgtcgtccgaatgggtcgattttctcacattgccggcctatgaccgcctgttagcgatt
ttacattaa

DBGET integrated database retrieval system