KEGG   Sulfobacillus acidophilus TPY: TPY_0121Help
Entry
TPY_0121          CDS       T01576                                 

Gene name
aceB
Definition
malate synthase A
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:say01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:say00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:say00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
136478..138046
Genome map
AA seq 522 aa AA seqDB search
MDIKGPTVPGSERILTSDALTFLEDLHRTFNPRRLERLRARQEIQQRIFQGWRPDFRPDT
REIRESEWTVGTIPADLTDRRVEITGPTDRKMVINALNSGARVFMADFEDANSPTWTNLV
LGQMNLIDAIERTITFESPQGETYRLKDQVATLVVRPRGWHLPERHLTVDGEPMAGALVD
FGLYVFHNARRLVERGSAPYLYLPKLENMEEAQLWEDVLGWAEERVGLPFGTMKVTVLIE
TILAAFEMEEILWALRPHIVGLNAGRWDYLFSIIKKFRRQPDVMPADRQQITMTVPFMRA
YTELLVKTCHRRGAYAIGGMAAFIPSRRDPEINRVALAKVEDDKEREARDGFDGTWVAHP
DLVPVATAVFDRVLGPRPHQRDRQRDDVVVTADDLLDFRVPGGTMTEAGLKNNVAVAIQY
LAAWLGGSGAVGLYNLMEDAATAEIARAQVWQWITHGVRLSDGKPVTAQLVERLIQEGLQ
EWGAHWPERDAAVDVFRSVALSSEWVDFLTLPAYDRLLAILH
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
gtggacatcaagggtccaacggttccgggaagcgaacgcattttaacatcggacgcgctc
acctttctggaggatttgcatcggacctttaacccgcggcggttggagcggttacgcgcc
cgtcaggaaatccaacaacgcatctttcagggatggcggccggactttcggccggatacc
cgagagatacgggaatccgaatggacggtgggaaccatacccgccgatctcacggatcgc
cgggtggaaatcaccggtccgacggatcgcaaaatggtgattaatgccctgaattccggg
gctcgggtctttatggccgacttcgaagacgcgaacagtccgacttggaccaacctggtt
ttgggtcagatgaacttaatcgacgcgattgagcggacgattacgttcgaatcgcctcag
ggggagacataccgcttaaaggatcaggtggccaccttggtggtgcgaccgcggggatgg
catttgcccgagcggcatctgacggtagacggtgaaccgatggcgggagccttggtcgat
ttcggactgtacgtgtttcacaacgcccgccgactggtggaacgagggagtgccccctat
ttatatttgccgaaactcgaaaacatggaagaagcccagttgtgggaagacgtgctcggc
tgggcggaggagcgggtggggcttcccttcggcaccatgaaagtgacggtactgattgaa
accattttagcggcttttgaaatggaagagattttgtgggccttgcgtccgcacattgtg
ggattgaatgcgggccgctgggactatctgttcagcattattaagaaattccgtcgccaa
ccggacgtcatgccggccgaccggcagcaaattaccatgaccgtgccgtttatgcgggca
tacaccgaacttttggtcaaaacctgtcatcggcggggggcttatgccattggaggcatg
gcggcatttatcccgagccgccgggatccggagattaaccgcgtggcgctggcgaaagtc
gaggacgacaaagagcgggaagcgcgtgacggattcgacgggacctgggtggcccatccc
gacctcgtgccggttgcgaccgccgtttttgaccgggtgctggggccgcgtcctcatcaa
cgcgaccgccaacgggacgatgtggtcgtaaccgccgacgatttactggatttccgggta
cccggaggcaccatgaccgaggcgggactgaaaaataatgtggcggttgccatccaatac
ttggcggcttggctcggcggttcgggggcggtggggctttataacctgatggaggatgcg
gcgaccgcggaaattgcccgggcccaagtgtggcagtggattacccatggcgtgcggttg
tccgacggtaagccggtgacggcccaactggtggaacggttaattcaagaaggccttcag
gaatggggagcccattggcccgaacgggatgcggcggtggacgttttccggtcggtcgcc
ttgtcgtccgaatgggtcgattttctcacattgccggcctatgaccgcctgttagcgatt
ttacattaa

DBGET integrated database retrieval system