KEGG   Sulfobacillus acidophilus TPY: TPY_0130Help
Entry
TPY_0130          CDS       T01576                                 

Gene name
recR
Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
say  Sulfobacillus acidophilus TPY
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:say00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TPY_0130 (recR)
DNA repair and recombination proteins [BR:say03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      TPY_0130 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
146094..146690
Genome map
AA seq 198 aa AA seqDB search
MLYPEPIQDLVQELAKLPGIGPKTAQRLAFFLLNMPKGEAEQLAQAIIQARQRIRYCSEC
FNFTDADPCFICKNPARDAGWIMVVEHPKDVVAMEKTREFKGRYHVLHGAISPMEGIGPD
ELKIRELVTRLERVNPKEIVLATSSSLEGEATALYLARLLKPMGFKVTRIARGLPMGGDL
DYTDEMTLTKALEGRQDI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgttatatccggaacccattcaagacttggtgcaagaattggccaaactacccggcata
gggcctaaaacggctcaacgattggctttttttctattaaacatgcccaaaggcgaagcc
gagcaattagcccaggcgattatccaggcgcgtcagcgcatccgctattgctcggaatgc
ttcaattttaccgatgccgatccgtgttttatttgtaaaaaccctgcgcgggacgccggc
tggattatggtggtcgagcacccgaaagatgtggtcgcgatggaaaaaacccgcgaattt
aaagggcgctatcatgtcttgcacggggcgatttcccccatggaagggatcggcccggac
gagttgaagattcgcgagctggtcacgcggttggagcgggtgaaccctaaagaaatcgtc
ttggcgaccagttccagtttggaaggggaagccacggcgctgtatttggcccgcttatta
aagccgatgggctttaaagtcacgcgtattgcgcgcggcttgcccatgggcggcgatttg
gattatacggatgaaatgaccttaaccaaagccctggaaggccgccaagacatctag

DBGET integrated database retrieval system