KEGG   Sulfobacillus acidophilus TPY: TPY_0130Help
Entry
TPY_0130          CDS       T01576                                 

Gene name
recR
Definition
(RefSeq) DNA replication and repair protein RecR
  KO
K06187  
recombination protein RecR
Organism
say  Sulfobacillus acidophilus TPY
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:say00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TPY_0130 (recR)
DNA repair and recombination proteins [BR:say03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      TPY_0130 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
146094..146690
Genome map
AA seq 198 aa AA seqDB search
MLYPEPIQDLVQELAKLPGIGPKTAQRLAFFLLNMPKGEAEQLAQAIIQARQRIRYCSEC
FNFTDADPCFICKNPARDAGWIMVVEHPKDVVAMEKTREFKGRYHVLHGAISPMEGIGPD
ELKIRELVTRLERVNPKEIVLATSSSLEGEATALYLARLLKPMGFKVTRIARGLPMGGDL
DYTDEMTLTKALEGRQDI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgttatatccggaacccattcaagacttggtgcaagaattggccaaactacccggcata
gggcctaaaacggctcaacgattggctttttttctattaaacatgcccaaaggcgaagcc
gagcaattagcccaggcgattatccaggcgcgtcagcgcatccgctattgctcggaatgc
ttcaattttaccgatgccgatccgtgttttatttgtaaaaaccctgcgcgggacgccggc
tggattatggtggtcgagcacccgaaagatgtggtcgcgatggaaaaaacccgcgaattt
aaagggcgctatcatgtcttgcacggggcgatttcccccatggaagggatcggcccggac
gagttgaagattcgcgagctggtcacgcggttggagcgggtgaaccctaaagaaatcgtc
ttggcgaccagttccagtttggaaggggaagccacggcgctgtatttggcccgcttatta
aagccgatgggctttaaagtcacgcgtattgcgcgcggcttgcccatgggcggcgatttg
gattatacggatgaaatgaccttaaccaaagccctggaaggccgccaagacatctag

DBGET integrated database retrieval system