KEGG   Sulfobacillus acidophilus TPY: TPY_0143Help
Entry
TPY_0143          CDS       T01576                                 

Gene name
ysiB
Definition
enoyl-CoA hydratase/isomerase family protein
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:say00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    TPY_0143 (ysiB)
  Lipid metabolism
   00071 Fatty acid degradation
    TPY_0143 (ysiB)
Enzymes [BR:say01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     TPY_0143 (ysiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
154908..155663
Genome map
AA seq 251 aa AA seqDB search
MSVLTVERRDQVAIWRMSHPPVNAINGELLQALADEIEKVRLDEAVRAVVITGNGPTFAA
GADVMGFLQMGGSLADFQQAGARLFRQIEMHPKPFVAAVNGVAYGGGNELAMACDIRVAS
KNARFGQPEVNLGIIPAWGGTWRLPDLVGRSVATRLLLTGDPISAEEAWRIGLVDRVVDA
DVLLDYAINIADRLASLAPRALAELKQLLARRGPESPKAEAEAAARLMTTADAVEGVMAF
QQKRRPRFQGR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgttaacggttgagaggagagaccaggtcgcgatttggcgaatgagccatccg
ccggtgaatgccattaacggggagcttttgcaagcgttggcggacgagatagaaaaagtg
cgtctggacgaggcggtgcgggccgtcgtgattacggggaacggtccgacctttgcggcc
ggcgccgacgtgatggggtttttacagatgggcggcagcttggcggacttccagcaggcg
ggggcccggttgtttcgccagattgaaatgcatccgaagccctttgttgcggcggtgaat
ggggtcgcttacggaggcggcaacgagttggccatggcctgtgacattcgggtggccagc
aaaaacgcccggtttggtcaacccgaagtgaatttggggattattcccgcttggggagga
acctggcgactgccggacctggtgggccgttcggttgcgacccgccttttgttaaccgga
gaccccatttcagcagaagaagcctggcgtatcggcttggtcgatcgggtggtcgatgcc
gatgtgttgctcgattatgcgataaatatcgccgaccgcttagcgagtttggcacctcgg
gctttggcggagctgaagcagctgctggcccggcgcggtcccgaaagcccgaaagccgaa
gccgaagcggccgcacgtttgatgacgacggccgatgccgtggaaggcgttatggctttt
caacaaaagcgtcgcccccgatttcaaggccgatag

  All links  
No link information was found.   
DBGET integrated database retrieval system