KEGG   Sulfobacillus acidophilus TPY: TPY_0185Help
Entry
TPY_0185          CDS       T01576                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
say00900  Terpenoid backbone biosynthesis
say01100  Metabolic pathways
say01110  Biosynthesis of secondary metabolites
say01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:say00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TPY_0185 (ispE)
Enzymes [BR:say01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     TPY_0185 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AEJ38400
UniProt: F8I4E4
Position
196444..197307
Genome map
AA seq 287 aa AA seqDB search
MILWAQAKINLGLWVGPRQPTGYHLVDTVMYPIEVKDRIVLEPSHTLRCDSDTPGVPVGE
QNLMMRAYHWAREHWGPLPTVRMAVQKQIPLGAGLGGGSADAGAVLRWAWHELGFGPPPA
VEGTEAIGMDVPFFVSGRPARARHYGELLTPVADRLQGFWVVLANPGWPLATHVVYRAWD
EVGRESDNRISEVIEGIERGELAVDGLQNDLEKAAFRVDPRLQAFRQALERWLFPVPCFL
SGSGATYYMLGSDPADPEWAYWAQDRLRDRGVAWVMAARLGMGKDEE
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgatattgtgggcgcaggccaaaattaatttaggcctctgggtggggccacgacagccg
acgggctatcatctcgtggatacggtgatgtatccgattgaggtgaaagaccggatcgtg
ttggagccgagccatacgcttcggtgtgacagcgatacgcccggagtacctgtcggcgag
caaaatctcatgatgcgggcatatcattgggcccgcgaacattggggacctttaccgacg
gtgcggatggcggtccaaaagcaaattccgctcggtgccggactagggggaggcagtgcg
gatgccggtgcggttttgcgctgggcctggcacgaactcggattcggtccacctccggcg
gtcgagggcacggaggccatcgggatggatgtgcccttttttgtttccggacgtccggcg
cgtgcgcgtcattatggcgagctcttgacgccggtggccgatcgactgcaagggttttgg
gtcgtcctggcgaatccgggttggcccttggccacgcatgtggtctaccgggcgtgggac
gaggtggggcgagagtccgacaatcgcatttctgaagtcattgagggcatagagcgcggc
gaactggcggtcgacgggttacaaaacgatttggaaaaggccgcctttcgggtggaccct
cggcttcaagcatttcggcaggctctcgaacgctggctttttccggtgccctgcttttta
tccggaagtggggcaacgtattatatgctaggatcggatccggccgatcccgaatgggcg
tattgggcacaggatcgtttacgcgatcggggggtggcttgggttatggccgcccgcttg
ggtatgggaaaggatgaggaatag

DBGET integrated database retrieval system