KEGG   Sulfobacillus acidophilus TPY: TPY_0214Help
Entry
TPY_0214          CDS       T01576                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:say00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TPY_0214 (galU)
   00052 Galactose metabolism
    TPY_0214 (galU)
   00500 Starch and sucrose metabolism
    TPY_0214 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    TPY_0214 (galU)
Enzymes [BR:say01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     TPY_0214 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
221609..222487
Genome map
AA seq 292 aa AA seqDB search
MHKAVIPAAGLGTRFLPATKAQPKEMLPIIDTPTIQLVVEEAVASGIDDFLVVIGRDKGS
IEDHFDRAPELEEFLRTRGKDDLLDIVQAVSRLANLHFIRQKVPMGLGHAVLQARRHVGQ
DPFAVLLGDDVMVGQPPVLSQLIARWQPGVSVVAVERVSREEASRYGVVFGQWDAQGVFR
VNRLVEKPAPADVPPEPLAIMGRYVLEPDIFQALAEVTPGQGGEVQLTDALDLLARERQL
IAVPYQGKRYDVGEKLGFVKATIEAALDRADLRDALIPYLKELLARVTMPSL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgcataaggctgtcataccggccgccggtctcggcacccgatttttgccggctacgaag
gcccagccgaaagaaatgttgcccattatcgataccccgacgattcaacttgtcgtggaa
gaggcggttgcctccgggattgacgactttttagtggtgattgggcgagataaagggtcc
atcgaggaccatttcgatcgggctcctgaactggaggaatttttacgtacccggggtaag
gacgatttgttggatattgtgcaagccgtgagccgattggccaatttgcattttattcgg
caaaaagttccgatggggctcggtcatgccgttttacaggcccggcggcacgtggggcaa
gacccctttgccgtgctgttgggggacgacgtgatggtcggtcagccgcccgtgttgtct
caattaatcgcgcgttggcagccgggggtctcggtcgtcgccgtggaacgggtatcccgg
gaggaggcgagccgctatggcgtggtcttcgggcaatgggatgcccaaggggtctttcgg
gtaaaccggttggtggaaaagcccgccccggcggacgtaccgccggagcccttggccatt
atgggacggtatgtgcttgagcccgacatttttcaggcgttggcggaggtgaccccaggc
cagggcggtgaggtgcagttaaccgacgccttggatttgctggcccgggaacgtcagttg
attgcggtgccctatcagggtaaacgctatgacgtcggggaaaagttgggtttcgtcaag
gcgaccatcgaagcggctttggatcgcgccgatttgcgggacgctttgatcccctatttg
aaagagctcttggcccgcgtgaccatgccctcgctgtaa

DBGET integrated database retrieval system