KEGG   Sulfobacillus acidophilus TPY: TPY_0214Help
Entry
TPY_0214          CDS       T01576                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
say00040  Pentose and glucuronate interconversions
say00052  Galactose metabolism
say00500  Starch and sucrose metabolism
say00520  Amino sugar and nucleotide sugar metabolism
say01100  Metabolic pathways
say01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:say00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TPY_0214 (galU)
   00052 Galactose metabolism
    TPY_0214 (galU)
   00500 Starch and sucrose metabolism
    TPY_0214 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    TPY_0214 (galU)
Enzymes [BR:say01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     TPY_0214 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD DUF3645
Motif
Other DBs
NCBI-ProteinID: AEJ38429
UniProt: F8I4Y1
Position
221609..222487
Genome map
AA seq 292 aa AA seqDB search
MHKAVIPAAGLGTRFLPATKAQPKEMLPIIDTPTIQLVVEEAVASGIDDFLVVIGRDKGS
IEDHFDRAPELEEFLRTRGKDDLLDIVQAVSRLANLHFIRQKVPMGLGHAVLQARRHVGQ
DPFAVLLGDDVMVGQPPVLSQLIARWQPGVSVVAVERVSREEASRYGVVFGQWDAQGVFR
VNRLVEKPAPADVPPEPLAIMGRYVLEPDIFQALAEVTPGQGGEVQLTDALDLLARERQL
IAVPYQGKRYDVGEKLGFVKATIEAALDRADLRDALIPYLKELLARVTMPSL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgcataaggctgtcataccggccgccggtctcggcacccgatttttgccggctacgaag
gcccagccgaaagaaatgttgcccattatcgataccccgacgattcaacttgtcgtggaa
gaggcggttgcctccgggattgacgactttttagtggtgattgggcgagataaagggtcc
atcgaggaccatttcgatcgggctcctgaactggaggaatttttacgtacccggggtaag
gacgatttgttggatattgtgcaagccgtgagccgattggccaatttgcattttattcgg
caaaaagttccgatggggctcggtcatgccgttttacaggcccggcggcacgtggggcaa
gacccctttgccgtgctgttgggggacgacgtgatggtcggtcagccgcccgtgttgtct
caattaatcgcgcgttggcagccgggggtctcggtcgtcgccgtggaacgggtatcccgg
gaggaggcgagccgctatggcgtggtcttcgggcaatgggatgcccaaggggtctttcgg
gtaaaccggttggtggaaaagcccgccccggcggacgtaccgccggagcccttggccatt
atgggacggtatgtgcttgagcccgacatttttcaggcgttggcggaggtgaccccaggc
cagggcggtgaggtgcagttaaccgacgccttggatttgctggcccgggaacgtcagttg
attgcggtgccctatcagggtaaacgctatgacgtcggggaaaagttgggtttcgtcaag
gcgaccatcgaagcggctttggatcgcgccgatttgcgggacgctttgatcccctatttg
aaagagctcttggcccgcgtgaccatgccctcgctgtaa

DBGET integrated database retrieval system