KEGG   Sulfobacillus acidophilus TPY: TPY_0641Help
Entry
TPY_0641          CDS       T01576                                 

Gene name
mhpF
Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:say00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    TPY_0641 (mhpF)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TPY_0641 (mhpF)
   00650 Butanoate metabolism
    TPY_0641 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    TPY_0641 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TPY_0641 (mhpF)
   00622 Xylene degradation
    TPY_0641 (mhpF)
   00621 Dioxin degradation
    TPY_0641 (mhpF)
Enzymes [BR:say01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     TPY_0641 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
598376..599275
Genome map
AA seq 299 aa AA seqDB search
MAKLTAAIIGSGNIGTDLLYKLRRSDWIEPRWMVGIDPQSEGLARARAMGLETTHEGLKA
LLNSGVRPDLAFDATSARAHVRHAKMLRDLGIQAIDLTPAARGPYVIAAVNLGDHLDAPN
VNMVTCGGQATTPMVYAVSRVTRVSYAEIVATIASKSAGPGTRQNIDEFTETTAKALEVI
GGAAEGKAIIILNPADPPIYMRDTIYCDIPDATAEDQERIIASIRDMVRHVQQFVPGYHL
NRDPIFRDGMVSISIEVEGLGDFLPKYSGNLDIMTAAATRVGEAIAQHRLAHATGGMIQ
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattaacggcggcgatcatcggatccggcaatatcgggacggatttattatac
aaactgcgccgtagcgactggattgaaccccggtggatggtcgggatcgatccccaatcg
gaagggttggcgcgggctcgggccatgggcctggagacgacccacgaggggttaaaagcg
ttattgaatagtggggttcggcccgatttggcatttgacgccaccagtgctcgcgcccat
gtgcgccacgcgaaaatgttgcgggatttggggattcaagccattgacttgactccggcg
gcccggggcccttatgtcatcgcggcggtcaatttaggagaccatctcgatgcgccgaat
gtcaatatggtcacgtgtggcgggcaagccaccacgccgatggtctatgccgtcagtcgg
gtcacccgggtgagttatgccgaaatcgtcgcgacgattgccagtaagagtgccggccca
ggtacccgacagaacatcgacgaatttaccgagacgaccgccaaggccctggaagtgatt
ggcggggcggccgagggtaaggccatcattatcttgaatccggccgatccgccgatttac
atgcgggataccatttattgcgacattccggatgcgaccgccgaggaccaggaacggatt
atcgcgtccatccgggacatggtccggcacgtgcaacagtttgtcccgggctaccacctg
aatcgggaccccattttccgcgacggtatggtcagtatttccattgaagtggaagggctc
ggggattttctgcccaaatattccggaaatctcgacatcatgacggcggcggcgacacgc
gtgggcgaagcgattgcccaacatcggttggcacatgccacgggagggatgattcaatga

DBGET integrated database retrieval system