KEGG   Sulfobacillus acidophilus TPY: TPY_0641Help
Entry
TPY_0641          CDS       T01576                                 

Gene name
mhpF
Definition
(GenBank) acetaldehyde dehydrogenase (acetylating)
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
say00360  Phenylalanine metabolism
say00362  Benzoate degradation
say00620  Pyruvate metabolism
say00621  Dioxin degradation
say00622  Xylene degradation
say00650  Butanoate metabolism
say01100  Metabolic pathways
say01120  Microbial metabolism in diverse environments
say01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:say00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TPY_0641 (mhpF)
   00650 Butanoate metabolism
    TPY_0641 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    TPY_0641 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TPY_0641 (mhpF)
   00622 Xylene degradation
    TPY_0641 (mhpF)
   00621 Dioxin degradation
    TPY_0641 (mhpF)
Enzymes [BR:say01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     TPY_0641 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA TrkA_N F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AEJ38839
UniProt: F8I8E3
Position
598376..599275
Genome map
AA seq 299 aa AA seqDB search
MAKLTAAIIGSGNIGTDLLYKLRRSDWIEPRWMVGIDPQSEGLARARAMGLETTHEGLKA
LLNSGVRPDLAFDATSARAHVRHAKMLRDLGIQAIDLTPAARGPYVIAAVNLGDHLDAPN
VNMVTCGGQATTPMVYAVSRVTRVSYAEIVATIASKSAGPGTRQNIDEFTETTAKALEVI
GGAAEGKAIIILNPADPPIYMRDTIYCDIPDATAEDQERIIASIRDMVRHVQQFVPGYHL
NRDPIFRDGMVSISIEVEGLGDFLPKYSGNLDIMTAAATRVGEAIAQHRLAHATGGMIQ
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattaacggcggcgatcatcggatccggcaatatcgggacggatttattatac
aaactgcgccgtagcgactggattgaaccccggtggatggtcgggatcgatccccaatcg
gaagggttggcgcgggctcgggccatgggcctggagacgacccacgaggggttaaaagcg
ttattgaatagtggggttcggcccgatttggcatttgacgccaccagtgctcgcgcccat
gtgcgccacgcgaaaatgttgcgggatttggggattcaagccattgacttgactccggcg
gcccggggcccttatgtcatcgcggcggtcaatttaggagaccatctcgatgcgccgaat
gtcaatatggtcacgtgtggcgggcaagccaccacgccgatggtctatgccgtcagtcgg
gtcacccgggtgagttatgccgaaatcgtcgcgacgattgccagtaagagtgccggccca
ggtacccgacagaacatcgacgaatttaccgagacgaccgccaaggccctggaagtgatt
ggcggggcggccgagggtaaggccatcattatcttgaatccggccgatccgccgatttac
atgcgggataccatttattgcgacattccggatgcgaccgccgaggaccaggaacggatt
atcgcgtccatccgggacatggtccggcacgtgcaacagtttgtcccgggctaccacctg
aatcgggaccccattttccgcgacggtatggtcagtatttccattgaagtggaagggctc
ggggattttctgcccaaatattccggaaatctcgacatcatgacggcggcggcgacacgc
gtgggcgaagcgattgcccaacatcggttggcacatgccacgggagggatgattcaatga

DBGET integrated database retrieval system