KEGG   Sulfobacillus acidophilus TPY: TPY_0690Help
Entry
TPY_0690          CDS       T01576                                 

Gene name
paaG
Definition
(RefSeq) enoyl-CoA hydratase/isomerase
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:say00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    TPY_0690 (paaG)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TPY_0690 (paaG)
   00650 Butanoate metabolism
    TPY_0690 (paaG)
  Lipid metabolism
   00071 Fatty acid degradation
    TPY_0690 (paaG)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TPY_0690 (paaG)
   00310 Lysine degradation
    TPY_0690 (paaG)
   00360 Phenylalanine metabolism
    TPY_0690 (paaG)
   00380 Tryptophan metabolism
    TPY_0690 (paaG)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TPY_0690 (paaG)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    TPY_0690 (paaG)
   00281 Geraniol degradation
    TPY_0690 (paaG)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TPY_0690 (paaG)
   00627 Aminobenzoate degradation
    TPY_0690 (paaG)
   00930 Caprolactam degradation
    TPY_0690 (paaG)
Enzymes [BR:say01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     TPY_0690 (paaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
641871..642638
Genome map
AA seq 255 aa AA seqDB search
MSVLLEERRGPVAVLTLNRPEVLNALNSELMEELSQTLDRIDQDPVVRVVVLTGNERAFA
AGADIQELYHNTPVTMLQSKQINRWESIRKFSKPLIAAVRGWALGGGMELVMACDMVICG
DDAHFGQPEIKIGVMPGAGGTQRLTKTIGKVRAMEMVLTGRTIDADEAFRMGLVNRVVPT
EQVVDHAVSLAETIAGMPPVAVRLAKESVLTALDTPLEVGLTHERRLFSLLFGTEDQKEG
MQAFLEKRKPEFKGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtcttattggaagagcggcggggaccggtcgccgtattgacgttaaaccggccg
gaggtgttgaatgcgcttaatagcgaattaatggaagaactgagccaaacgctagaccgc
atcgatcaagatcctgtggtacgggtggtagtgcttaccggcaacgaacgggcgtttgcg
gccggggccgatattcaagagctctatcacaatacgccggtcaccatgttgcaatccaaa
cagattaatcgttgggaatcgattcgcaagttttccaagccgctgattgcggcggtacgg
ggttgggcgttgggaggcgggatggaattagttatggcctgcgatatggtcatctgcggc
gatgatgctcattttggccagccggaaattaaaattggcgtgatgccgggagcaggcggc
acccagcggctaaccaaaacgataggcaaggtgcgggccatggaaatggtgctcaccgga
cgtaccatcgatgccgatgaggcttttcggatgggactggtcaatcgcgtcgtgccgacc
gaacaagtggtggaccacgccgtatcgctggccgaaacgattgccggcatgccgcccgtc
gccgtgcgattggccaaagaatcggtgctgaccgccctcgatacgcctctggaagtggga
ttaacgcatgaacggcggctattcagtttgctctttggcaccgaggaccagaaagaaggc
atgcaagcttttttggaaaaacgtaaaccggaattcaaaggccgatag

DBGET integrated database retrieval system