KEGG   Sulfobacillus acidophilus TPY: TPY_0767Help
Entry
TPY_0767          CDS       T01576                                 

Gene name
manB
Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:say00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TPY_0767 (manB)
   00030 Pentose phosphate pathway
    TPY_0767 (manB)
   00051 Fructose and mannose metabolism
    TPY_0767 (manB)
   00052 Galactose metabolism
    TPY_0767 (manB)
   00500 Starch and sucrose metabolism
    TPY_0767 (manB)
   00520 Amino sugar and nucleotide sugar metabolism
    TPY_0767 (manB)
  Nucleotide metabolism
   00230 Purine metabolism
    TPY_0767 (manB)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TPY_0767 (manB)
Enzymes [BR:say01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     TPY_0767 (manB)
    5.4.2.8  phosphomannomutase
     TPY_0767 (manB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(715565..716947)
Genome map
AA seq 460 aa AA seqDB search
MNTSIFREYDIRAVVDVDLTDEEVTTLGQAFGTFLRDRQVTSAVLGWDSRASSPRWRDRM
TEGLIKTGIHVIDIGQVTTPIFYFARIHFDQPAGVMITASHNPAEFNGFKLAYGPATIYG
EDIQEVRRIMERGEFAEGRGSRTEANPVPAYLTMLKEKIRLGPRRPKVVVDCGNGTPSLF
AQDVMKAFGVEAIPLYCTPDPTFPHHHPDPVVAKNLTDLIAAVKREGADLGVAFDGDGDR
IGVVDETGEIIWGDRLMVLYWREIAPKYPGTPAIIEVKCSQTLYDEVARLGAKPLFYKTG
HSLIKAKMREMGAVFTGEMSGHMFFADEYYGYDDAFYAAGRLFRILSETDAPLSRLLADV
PHLPATPEIRIDCPDEQKMAVVASLQKTYQARSDVSVIDVDGLRVVFPYGWGLIRASNTQ
PALVARAEADTEEHLKMITEDFDQALRQFPFVPPVDWSGE
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaccagtatttttcgggaatatgatatccgtgcggtggtggatgtcgatttaacg
gacgaggaagtgaccactctgggtcaggccttcggcaccttcctgcgggaccgtcaagtg
accagtgcggtgctaggctgggacagtcgggcgtcctcaccccgatggcgcgaccggatg
acggagggtctcatcaaaaccggtatccatgtgatcgacattggacaagtgaccaccccc
atcttttattttgcccgcatccatttcgatcaaccggccggggtcatgatcaccgccagc
cataatcccgccgagtttaacgggtttaaattggcttatggacccgccaccatctacggt
gaggatatccaagaagtccggcgcatcatggaacgcggcgagtttgcggaaggccgcggt
tcccgtaccgaggccaacccggtgcccgcctatctgaccatgttgaaagaaaaaatccgg
ctcgggccgcgccgccccaaggtcgtagtcgattgcggcaacggaacgccgagtttattt
gcccaggacgttatgaaggcctttggagtcgaggcgattccgctttattgcacgcccgac
ccgacgtttcctcaccatcatccggatcccgtggtcgcgaaaaacttaaccgatttaatt
gccgcggtgaagcgagaaggggccgacttaggagtcgcatttgacggtgacggggatcgc
atcggagtcgtggacgagacaggcgagattatctggggtgaccggttaatggtgctctat
tggcgagaaatcgcgcccaagtatcccggcacgccggccattatcgaagtcaagtgttcc
cagaccctttatgacgaagtggcccgactcggtgccaagccgttattttataaaaccggc
cattccttgattaaggccaagatgcgggaaatgggcgccgtattcaccggggaaatgagc
gggcatatgttttttgccgatgaatactacggatatgacgatgcgttttacgcggcgggt
cggctattccgtattctctccgaaaccgatgccccgttatcccggttattggccgacgtt
ccgcatctgccggcaacgccggaaatccgcatcgactgtcccgacgaacaaaaaatggcc
gtggtcgccagtcttcaaaaaacctatcaggcccgttcagacgtctcggttatcgacgtc
gacggcctgcgagtcgtctttccctatggctggggccttattcgggcatccaatacgcaa
ccggccttagtggcccgagcggaagccgacaccgaagagcatttaaaaatgattaccgag
gattttgatcaagccctccggcaattccccttcgtgccgccggttgattggtccggcgaa
taa

DBGET integrated database retrieval system