KEGG   Sulfobacillus acidophilus TPY: TPY_0912Help
Entry
TPY_0912          CDS       T01576                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
say00340  Histidine metabolism
say01100  Metabolic pathways
say01110  Biosynthesis of secondary metabolites
say01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:say00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    TPY_0912 (hisD)
Enzymes [BR:say01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     TPY_0912 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AEJ39102
UniProt: F8IAI7
Position
complement(858439..859644)
Genome map
AA seq 401 aa AA seqDB search
MSDPLIGDILDAVRDRGVKAVLEYTEAFDHVRLSPDDLIWNPLAEAPAVIDPAVREAVDF
AMDQIRRFHEATRPAPVTVNQAPGLILREVFQPLGRVGLYVPNGQFPLVSSLMMTAIPAQ
VAGVTDLVVAIAPRGHVTSDPVWLYVLQKLGIRQVLRVGGAQAIAALGYGLPGLPPVDLI
AGPGNRYVAWAKQELFRRGVTGIDVIAGPSEVLVISQDTAFAPLVALDLLAQAEHDPDAK
AYLVSWNPDLIAAVKDYIASHVNPADRLGQIEYILVANANEAVQTANRIAPEHLGLIGAE
VEPLWPQLTTAGALFVGRLAGQALGDYVAGPSHVLPTGHTGRFLSGLSTRTFMRRISVIQ
TEDALPAAFLEAGQVLAHLEGLRYHEQSLAVRQQLRGQEGL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatccgttaatcggagacattttggacgccgtccgcgatcgcggggtcaaagcc
gtcttagagtacacggaagcctttgatcacgttcggttgtcgcccgacgatttgatttgg
aaccctctcgcagaagccccggccgtcattgatccggccgtccgggaagccgtcgatttt
gccatggatcaaattcgtcgctttcacgaggcaacccgaccggccccggtgaccgtcaac
caagctcccgggctcattctccgcgaggtcttccagcccttaggacgggtgggactttat
gtacccaacggccaatttcctttggtgtccagtttaatgatgaccgccatcccggcccaa
gtcgcgggggtcacggatctggtcgtggccattgccccccggggtcatgtcacgtcggat
ccggtctggctctatgtcctgcagaaactgggcattcgccaagtgttgcgggtgggcggg
gcgcaagccatcgccgcgctcggttacggattgccgggattaccgccggtggacttaatc
gccggtcccgggaaccgctatgtcgcgtgggccaaacaagaactctttcgccgcggggtg
accggcatcgacgtcattgcaggtccgtcggaagtcttggtgataagccaagatacggct
ttcgcacctttggtcgccttggatttgttggctcaggcggaacacgaccccgacgcgaaa
gcgtatttggtcagttggaacccggacctgatcgcggccgtcaaagattatatcgcctct
cacgtcaaccccgcagaccgcctaggccaaatcgagtatattttggtggcgaatgcgaac
gaagccgttcagaccgccaaccgcatagcccccgaacatctagggcttatcggggcggag
gtagagcccctctggcctcaactgaccacggcgggtgccctctttgtgggtcgactggcc
gggcaagccttgggcgattatgtcgccggcccgagccacgtattgccgaccggtcacacc
ggccgcttcttgtccgggctttcgacccgtacatttatgcgccgaatcagtgtcattcaa
accgaggatgctttaccggccgcgtttttggaagccggacaggtattggcccacttggaa
ggcttgcggtatcacgaacaatcgttagccgtccgacaacaattacgcggtcaggagggg
ctctaa

DBGET integrated database retrieval system