KEGG   Sulfobacillus acidophilus TPY: TPY_1053Help
Entry
TPY_1053          CDS       T01576                                 

Gene name
glk
Definition
ROK family glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:say00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TPY_1053 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TPY_1053 (glk)
   00052 Galactose metabolism
    TPY_1053 (glk)
   00500 Starch and sucrose metabolism
    TPY_1053 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    TPY_1053 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TPY_1053 (glk)
   00524 Butirosin and neomycin biosynthesis
    TPY_1053 (glk)
Enzymes [BR:say01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TPY_1053 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
984286..985248
Genome map
AA seq 320 aa AA seqDB search
MGEYLAVDVGGTKIAIGLGTDTGQLLETAILKTPAEKAPQDVLDQIADQALAMVHRHGVA
LEAVGVGSPGPLDGPVLLKTSNLSHWEGLNWETGLNTRLHVPVYVENDATAAAVGEWMFG
AGKGTRDLVYVTISTGIGAGFVVNGRVMSGFRGNAGEFGHLVLDPAGPWCPAGHYGCVES
YASGSALTREGRRHQKESPYLDGKESVDAKTVLQGWMRDDPVCGQIVDAATERLGRGLSY
LIDLMNPERIIVGGGVGVNAPERYLTMIESYARQYALPAMMAVVQFRRAQLGEQSGVMGA
LAVAINRQHNPNSLGHAKES
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagtatctggcagtggatgtaggcggcacgaaaattgccatcgggctcggtacc
gacaccgggcagctattagagacagcgatcctgaaaactcccgcggaaaaagcgccccag
gacgttttagatcagattgccgaccaggcgctggcgatggtccatcgccacggggtggcc
ttagaggcggtcggggtcggctcgccgggcccgctcgacggtccggtattacttaaaacg
tccaatttaagccactgggaaggcctcaattgggagaccgggctcaatacccgcctacac
gtaccggtctatgtggaaaacgacgcgaccgccgcggccgtcggcgaatggatgttcgga
gccggcaaaggaacgcgcgacttagtgtacgtgaccatatccacgggaatcggggccggc
tttgtcgtaaacggacgcgtcatgtcaggttttcggggcaatgccggcgaatttgggcat
ctggtgcttgatccggccgggccttggtgtcctgccgggcactacggttgtgtggaaagt
tatgcctccgggtcggccctgacgcgggaagggcggcgtcatcaaaaagaaagcccctat
ctcgacggcaaggagagtgttgacgccaaaaccgtcctgcaaggatggatgcgggacgat
ccggtgtgcggacaaatcgtggacgcggcgaccgagcggttggggcgaggattatcttat
ttaattgatctgatgaatccggagaggattatcgtcgggggcggcgtcggcgtgaacgcg
cctgagcggtatctgacgatgattgagtcctatgcccggcaatatgccttgccggccatg
atggcggtggtgcaatttcgtcgcgcgcaattgggcgaacagtcgggggtcatgggcgct
ttggcggtggccattaatcgccagcataacccgaattcattgggtcatgctaaagaaagc
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system