KEGG   Sulfobacillus acidophilus TPY: TPY_1162Help
Entry
TPY_1162          CDS       T01576                                 

Gene name
trpC
Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:say00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TPY_1162 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TPY_1162 (trpC)
Enzymes [BR:say01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     TPY_1162 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1084959..1085726
Genome map
AA seq 255 aa AA seqDB search
MFLDRIVASVDARVEALRDEWARLEEKAQNMPPTRSLADALRADPGTLQVIAECKQRSPS
KGWLTDHYDPVAQAQGYQRAGAAAISVLTEPEFFAGDLAHLRAVREAVSIPVLRKDFIRH
PVQIAEARAAGADAVLLIIRILEPDQYRALYDYATRLGLDVLVEIHSPVEAEVALTAHPA
IIGVNNRDLDSFETRLSFSQEMALALGPDIIKVSESGIHQVEDLRQVRDWGYQAVLVGEA
LMRGRPLLEEWRANG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgaccgaattgtggcgtccgtcgatgcgcgggtcgaggcccttcgggacgaa
tgggcgcgactcgaagaaaaggcccaaaacatgccgccgacccgctcgctggccgatgcg
ttacgggccgatccggggacgcttcaggtgattgccgaatgcaagcaacgatcgccgtcc
aaagggtggttaaccgaccattatgacccggtcgcgcaagctcaaggctaccaacgggcg
ggggcggccgcgatatccgttctcaccgaaccggagttttttgccggcgatcttgcccat
ttgcgggcggtgcgggaagcggtatcgattccggttttacgtaaagacttcattcgccac
ccggtgcagattgcggaggcgcgggcggccggcgccgatgccgtgttattgattatccgc
attttggaaccggaccaatatcgagcgttgtatgattatgccacccgattggggcttgat
gttctggttgaaattcattccccggtggaggccgaggttgccttgaccgctcacccggcc
attatcggggtgaataaccgcgatttggactcttttgagacgcgtctgtctttttctcag
gaaatggctttagcgttggggccggacattatcaaagtcagcgaaagcggcattcatcag
gtagaggatttgcgccaggtccgggactgggggtatcaggccgtattagtgggagaggcc
ctgatgcgcggccgtccgttgttggaggaatggcgtgctaacggttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system