KEGG   Sulfobacillus acidophilus TPY: TPY_1164Help
Entry
TPY_1164          CDS       T01576                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:say00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TPY_1164 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TPY_1164 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TPY_1164 (trpB)
Enzymes [BR:say01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TPY_1164 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1086257..1087465
Genome map
AA seq 402 aa AA seqDB search
MATRVHKEEWPDQHGRFGRFGGRYVPETLMPAIEELEQAYRAARRDREFQKEFQSLLKDY
VGRPTPLRRADQMSAALGFDVYLKREDLNHTGAHKINNTIGQVLLARKMGKTRIIAETGA
GQHGVATATAAALFGLKAEVYMGREDVHRQALNVYRMKLLGAEVHAVDSGTKTLKDATNE
ALRDWVTNVRTTFYVIGSVVGPHPYPMMVRDFQSVIGREARRQYLALTGSLPTHIVAAVG
GGSNSMGIFYPFRHDPVALVGIEAAGEGIETGRHAASIHQAEPGILHGSLSYLLQDEDGQ
IQPAHSISAGLDYPGVGPEHAHFHDTGRATYEAITDQEALDAFYRLSRWEGIIPALESAH
AVAWVIKEAPRLKEQHARVLINLSGRGDKDIDAVLRYERGEA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgcgagtgcataaagaggaatggcccgatcaacacggccggttcggccgcttt
ggcggccggtatgtgccggaaacgttgatgccggcgattgaggagctggagcaggcctat
cgtgcggctcgacgggaccgggagtttcagaaggaatttcaaagcctattgaaagattac
gtcggacgaccgacaccgcttcgacgggccgatcaaatgagcgcggctctgggatttgat
gtctatctgaaacgggaagatttgaaccatacgggtgcccataaaattaataacacgatc
ggccaggtgctcttagcccgtaaaatgggtaaaacgcggatcattgcagaaaccggggcc
gggcagcatggcgtggcaacggccacggcggcggcgctgtttggcctcaaggcggaagtt
tacatgggccgggaggatgtgcatcgacaggccctcaacgtgtaccgcatgaagctttta
ggagcggaagtgcacgccgtcgactccggcaccaaaacgctgaaagacgcgaccaacgaa
gcattgcgcgattgggtgaccaacgtgcgtacgaccttttatgtcattgggtcggtcgtg
ggaccgcatccttacccgatgatggtccgggattttcaatccgtgatcggccgggaggcc
cgtcggcagtacctggctttgaccgggtcgttgccgacccacattgtggccgcggtcggg
ggcggatccaacagcatggggatcttctatccgtttcggcatgatccggtggcgctggtc
ggtatcgaagcggccggcgaaggtattgagaccggtcgccatgccgccagcatccaccaa
gcggaacccggtattttgcatggcagcctgagttatctcctgcaggacgaagacggtcaa
atccagccggcgcattcgatttcggccggtctcgactatcccggggtgggcccggagcac
gcccactttcatgataccggtcgggcgacctatgaggcaatcaccgatcaggaggcgctc
gacgctttttaccggttgtctcgctgggaagggatcatccctgcgcttgaaagtgcccac
gcggtcgcttgggtcatcaaagaggcgccccgcctcaaagaacagcacgctcgggtgctc
atcaatctatcgggccgtggcgataaagacattgatgcggttttgcgctatgagaggggg
gaggcgtaa

DBGET integrated database retrieval system