KEGG   Sulfobacillus acidophilus TPY: TPY_1165Help
Entry
TPY_1165          CDS       T01576                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
say00260  Glycine, serine and threonine metabolism
say00400  Phenylalanine, tyrosine and tryptophan biosynthesis
say01100  Metabolic pathways
say01110  Biosynthesis of secondary metabolites
say01130  Biosynthesis of antibiotics
say01230  Biosynthesis of amino acids
Module
say_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:say00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TPY_1165 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TPY_1165 (trpA)
Enzymes [BR:say01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TPY_1165 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth BtpA NanE PcrB ALF
Motif
Other DBs
NCBI-ProteinID: AEJ39355
UniProt: F8I1W0
Position
1087465..1088271
Genome map
AA seq 268 aa AA seqDB search
MNQRIQEAFVRARAEGRAALIPYLTAGYPRLDLLPDLVQAVSEAGADIIEIGIPFSDPLA
DGPVLQQAATIALANGTKIKDIFSVVAQLVPKAPPLVFLTYINPVFHMGMEVFVTHMREA
GVEGVIIPDLPWAEAEEMRTVTRSQGVALIPLAAPTSTDRHLKAIQHEGDGFVYGVSLTG
VTGVRDTLDAGVGELVRRIKAAGPLPVAMGFGISTPEQAHTVAQIADGVIVGSALVKHLQ
THPDMAVQAAYEFVRDLRNAVKIPISKA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagcgtatccaggaggcgtttgtacgagctcgtgccgagggacgggccgcctta
attccctatttaacggccggctatccgcggctggacttgttgccggatttggtgcaggcg
gtttcggaggcgggggccgacattattgaaatcggcatcccgttctccgatccgttggcg
gacggaccggttttgcaacaggccgcgacgattgcgctggcgaacgggacgaaaatcaag
gatattttttccgtcgtggcgcaattggtccccaaagccccgccgctggtctttttgaca
tatattaacccggtttttcatatggggatggaagtattcgtaacccatatgcgtgaagcc
ggggttgaaggggtaatcatccccgacttgccttgggcggaggccgaggagatgcgcacc
gtgacccggtcccagggggtggcgctgattcctttggccgcaccgacctccaccgatcgg
cacctcaaagccatccaacacgagggggatggatttgtctatggggtgtctttgaccggg
gttaccggggtacgggataccctggatgcgggagtcggtgaattagtccgccgcattaag
gcggccggacctttgccggtggccatgggattcgggatatcaacccctgaacaggcccat
accgtagcgcaaattgctgatggggtcattgtcggtagcgcattggtgaaacatttgcaa
acgcatcccgatatggccgtgcaggcggcctatgaatttgtgagggatctgcggaacgcg
gtaaaaattcctatctcgaaggcttga

DBGET integrated database retrieval system