KEGG   Sulfobacillus acidophilus TPY: TPY_1514Help
Entry
TPY_1514          CDS       T01576                                 

Gene name
tpiA
Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
say00010  Glycolysis / Gluconeogenesis
say00051  Fructose and mannose metabolism
say00562  Inositol phosphate metabolism
say00710  Carbon fixation in photosynthetic organisms
say01100  Metabolic pathways
say01110  Biosynthesis of secondary metabolites
say01120  Microbial metabolism in diverse environments
say01130  Biosynthesis of antibiotics
say01200  Carbon metabolism
say01230  Biosynthesis of amino acids
Module
say_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
say_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:say00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TPY_1514 (tpiA)
   00051 Fructose and mannose metabolism
    TPY_1514 (tpiA)
   00562 Inositol phosphate metabolism
    TPY_1514 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    TPY_1514 (tpiA)
Enzymes [BR:say01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TPY_1514 (tpiA)
Exosome [BR:say04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TPY_1514 (tpiA)
  Exosomal proteins of bladder cancer cells
   TPY_1514 (tpiA)
  Exosomal proteins of melanoma cells
   TPY_1514 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Cu2_monooxygen
Motif
Other DBs
NCBI-ProteinID: AEJ39698
UniProt: F8I550
Position
1434918..1435703
Genome map
AA seq 261 aa AA seqDB search
MQKARRPLLAANWKMYKSVADSLNYAEELVRRADEWVDLPADLLICPTALALWAVGQKLA
SYPVRVGAQNLDLGTEGAMTGALSARLIRAAGAQYVILGHSERRQHFGETDRLVAEKTRQ
ALDEGLMPIVCVGENDQENQQGLTTRVIQRQLAPVLEKLSPVDAASFVVAYEPIWAIGTG
KVPTYEDAQRVAQDIRQGILRQWGEEAASAVRVLYGGSVSPDNIGGFAAQPDIDGALIGG
ASLKVDNMVRMVQQWQEADKA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaggcacggcgcccattattggccgctaactggaaaatgtataaatcggtcgcg
gactctcttaactatgccgaggaattggtgcggcgtgccgatgaatgggtcgatttgccg
gcggatcttctcatttgcccgaccgccttggcgctatgggctgtggggcagaaactggcg
tcctatccggtgcgggtgggagcccagaatcttgacctaggaaccgaaggggcgatgacg
ggggctttgtcggctcggttaatccgagccgccggcgcccagtatgtcatattaggccat
tcggaacggcgtcagcactttggggaaaccgatcgcctagtggcggaaaaaacgcgtcag
gccctcgatgaagggttgatgccgattgtctgtgtcggagaaaacgatcaagaaaatcag
cagggattgacgacccgcgtgattcagcggcaattggctccggttttggaaaaattgagc
ccggtcgacgccgcgtcgttcgtggtggcctatgagcccatttgggccattggtaccggt
aaagtgccgacgtacgaggatgcccagcgggtggcccaggacattcggcaggggattctc
cgccagtggggtgaagaggcggcttcggcggtacgggtgctctacggagggtcggtttca
ccggataacattggcggattcgcggcccaaccggatatcgacggcgctttaatcggcgga
gcatcgttaaaagtggacaacatggtgcggatggtacaacaatggcaggaggcggacaag
gcatga

DBGET integrated database retrieval system