KEGG   Sulfobacillus acidophilus TPY: TPY_1514Help
Entry
TPY_1514          CDS       T01576                                 

Gene name
tpiA
Definition
Triose-phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:say01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:say01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:say00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:say00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:say00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:say00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1434918..1435703
Genome map
AA seq 261 aa AA seqDB search
MQKARRPLLAANWKMYKSVADSLNYAEELVRRADEWVDLPADLLICPTALALWAVGQKLA
SYPVRVGAQNLDLGTEGAMTGALSARLIRAAGAQYVILGHSERRQHFGETDRLVAEKTRQ
ALDEGLMPIVCVGENDQENQQGLTTRVIQRQLAPVLEKLSPVDAASFVVAYEPIWAIGTG
KVPTYEDAQRVAQDIRQGILRQWGEEAASAVRVLYGGSVSPDNIGGFAAQPDIDGALIGG
ASLKVDNMVRMVQQWQEADKA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaggcacggcgcccattattggccgctaactggaaaatgtataaatcggtcgcg
gactctcttaactatgccgaggaattggtgcggcgtgccgatgaatgggtcgatttgccg
gcggatcttctcatttgcccgaccgccttggcgctatgggctgtggggcagaaactggcg
tcctatccggtgcgggtgggagcccagaatcttgacctaggaaccgaaggggcgatgacg
ggggctttgtcggctcggttaatccgagccgccggcgcccagtatgtcatattaggccat
tcggaacggcgtcagcactttggggaaaccgatcgcctagtggcggaaaaaacgcgtcag
gccctcgatgaagggttgatgccgattgtctgtgtcggagaaaacgatcaagaaaatcag
cagggattgacgacccgcgtgattcagcggcaattggctccggttttggaaaaattgagc
ccggtcgacgccgcgtcgttcgtggtggcctatgagcccatttgggccattggtaccggt
aaagtgccgacgtacgaggatgcccagcgggtggcccaggacattcggcaggggattctc
cgccagtggggtgaagaggcggcttcggcggtacgggtgctctacggagggtcggtttca
ccggataacattggcggattcgcggcccaaccggatatcgacggcgctttaatcggcgga
gcatcgttaaaagtggacaacatggtgcggatggtacaacaatggcaggaggcggacaag
gcatga

DBGET integrated database retrieval system