KEGG   Sulfobacillus acidophilus TPY: TPY_1624Help
Entry
TPY_1624          CDS       T01576                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
say00020  Citrate cycle (TCA cycle)
say00310  Lysine degradation
say01100  Metabolic pathways
say01110  Biosynthesis of secondary metabolites
say01120  Microbial metabolism in diverse environments
say01130  Biosynthesis of antibiotics
say01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:say00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TPY_1624 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    TPY_1624 (sucB)
Enzymes [BR:say01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     TPY_1624 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: AEJ39806
UniProt: F8I5W4
Position
complement(1522887..1524086)
Genome map
AA seq 399 aa AA seqDB search
MKVPELGESVVEATVGRWLKQEGEAVSPGEPVVELETDKVNLEVAAETAGVITKILAPEG
STVAVGSSLATIEAGATAAPPAAVPPVSDSAPVVDEGVRATPDVRRLAKEQGVDLARLQG
SGPKGRIVRDDVLAATKPPENPVLPPPPPRAPQPEPRALSPDAAWSERQEEHIPMSSRRL
TIARRLVEAQHQAAMLTTFNEVDMSTVLAVRQRRRDAFKERYGVSLGLMSFFTKAVIGAL
KAFPRLNAEIRGQEMIIKHYYDIGIAVATDQGLVVPVLRNADRMTFAEIEQQVAELARRA
RDNKLTLDELKGGTFTITNGGVFGSLLSTPILNAPQVGILGMHKIQERPVAVNGQVEIRP
MMYIALSYDHRIVDGSEAVRFLVTVKQFIEDPEALLLEG
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggtaccggaattgggcgagtcggtggttgaagccaccgtaggccgttggttaaag
caggaaggggaggccgtctctccgggagaaccggtggtcgaactcgaaacggataaagtc
aatttggaagtcgcggccgaaacggcgggcgtgattacgaagattctggcgccggaaggc
agtacggtggcggtcggcagcagtctcgccaccatcgaggccggcgccaccgccgccccg
ccggcggcggtccccccggtgtccgactcggcgccggtggtggacgaaggggtccgggcg
acgcccgatgttcggcgattggccaaagaacaaggggttgatttagctcggctccaaggc
tcgggtcccaaggggcgcatcgtccgagacgacgtcttggccgccaccaaaccgcccgag
aatccggttttaccgccgccaccccctcgagctccgcaaccggaaccccgggccctatca
cccgatgcggcgtggtccgaacggcaggaagaacatatccccatgtcgtctcgtcggctg
accatcgcacgccgcttggtcgaagcgcaacatcaggcggccatgctcaccacgtttaac
gaagtcgacatgtctacggtgctcgccgtccgtcagcgtcgacgagacgcgtttaaagaa
cggtacggtgtgagtcttggattgatgtcgttttttaccaaggcggttattggcgccttg
aaagccttcccgcggttaaacgcggaaatccgtggtcaggaaatgattattaagcattac
tacgatatcggcattgccgttgccaccgatcaaggcttagtcgtcccggtgttacgaaac
gccgaccggatgacgtttgccgagattgagcaacaggttgcggaattggcccgccgggcc
cgcgacaataagctgacgttagacgaactgaaaggcggcacgtttacgattaccaacggc
ggggtgtttggatcacttttgtcgacgcctatcttaaacgccccccaagtcggcatcttg
ggcatgcataaaattcaagagcgtccggtggcggttaacggccaagtagagatccggccg
atgatgtacatcgccttgtcctacgaccatcggattgtggacggaagtgaagccgttcgg
tttttagtgaccgtcaagcagtttattgaagaccccgaggccttgttgttggaggggtag

DBGET integrated database retrieval system