KEGG   Sulfobacillus acidophilus TPY: TPY_2021Help
Entry
TPY_2021          CDS       T01576                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:say00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TPY_2021
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TPY_2021
   00052 Galactose metabolism
    TPY_2021
   00500 Starch and sucrose metabolism
    TPY_2021
   00520 Amino sugar and nucleotide sugar metabolism
    TPY_2021
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TPY_2021
   00524 Butirosin and neomycin biosynthesis
    TPY_2021
Enzymes [BR:say01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TPY_2021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1928489..1929379)
Genome map
AA seq 296 aa AA seqDB search
MMTSLNHVLGFDFGGTKAAIAIGAPDGSVVWEQRLQVADFDSAEELVTAAIRYGKAATEG
MGIAAVGVATMGVTTPEGIDLAPNVNGWQTLNLWKMFHESFSCPVGFENDVRAALLAEQA
WGNLRPYTYSAYLNLGSGIALAFFLDGRLYKGAHQVAGEIGYAWEPGDLGYLDHHAPLEE
RVGGLALNMKIQREFPGYESVLDAFHRGWHDPAVHAFLIRTLATIARYVGYALLAVDVEA
VAVGGGISAQFERIAPIFLALWRRYLPKPPLVMNSAFYGRAGLMGALKVAWDSLGR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgatgacttctctgaaccatgttttaggattcgacttcggcggaaccaaagcggcgata
gctattggcgctccggacggctcggtggtctgggaacagcggttacaggtggcagatttt
gattcggcggaggaattggtgaccgccgccatccgttacgggaaagcggcaaccgagggg
atggggattgccgcggtgggcgtagcgaccatgggggtgacgaccccggagggcattgac
ctggctcctaatgtgaacggctggcagacactaaatctctggaagatgtttcacgagagc
ttttcatgtccggtgggatttgaaaacgatgtacgggcggcgcttttagccgaacaggcc
tgggggaatttgcggccgtatacttattccgcttatctgaatctgggttccggcatcgct
ttggcttttttcttggacggacggttatataaaggggcccaccaggtggccggagaaatt
ggctacgcttgggaaccgggggatttgggatatttggaccaccatgcgccgttggaggaa
cgggtgggcggcttggcgctcaatatgaaaattcaacgcgaatttcccggatacgagtcg
gttctagacgcgtttcaccgaggatggcacgatcccgcggttcacgcgtttttgattcga
acattggcgaccatcgcacgttatgtgggctatgcgctcttggcggtagacgtcgaggcg
gttgccgtaggcggagggatttccgcccagttcgaacgcattgcccctatttttctcgcg
ctatggcggagatatttgccgaaaccgcccctagtcatgaatagtgcgttctacggacgc
gcaggcctcatgggcgcattgaaagtcgcatgggacagtttagggcgatga

DBGET integrated database retrieval system