KEGG   Sulfobacillus acidophilus TPY: TPY_2022Help
Entry
TPY_2022          CDS       T01576                                 

Gene name
melA
Definition
glycoside hydrolase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:say00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:say00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1929376..1930710)
Genome map
AA seq 444 aa AA seqDB search
MVKITLVGAGSMHFTRDLIWNLLLHPQADRIEWRLFDIDADRLRISYRLVQEIGRQLHVT
PRAVTVDTQREALQGADFVINVVQVGGFEATRRDFDIPERYGIVQTIGDTLGVGGIFRAL
RTIPVVLDLVRDMEDVCPEAVLLNYTNPLSMVVMAIARISGIQAYGLCESPRTTADTLSR
YLEIPPDRLNWMTAGINHMAWVLRLEAEGRDLYPTLRSLADDPETWRKDAVRFELMKAFG
YFVTESSEHNAEYGPWFITHPDEIRRLGIPLGELLRRSANYLRDFEAYKTEGIREDFTFP
RHPPFQYAAELITHWMTGEDLTFYGSVMNHGLIDNIMPTIAVEVPCVLTQGEIFPVHVGP
LPDVLAALNNRAGAIQDLTVQAVLRRNREDLYHALLLDPVVSSRLTVDQTVSLANELLEA
HKGIVPELKTRRVFGNTSFSGEGT
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaattacgctcgtcggcgccggaagcatgcattttacccgtgatttgatatgg
aatctattattacatccccaggcggaccggattgaatggcggttatttgatatcgatgcc
gaccggttacggatttcgtatcgtctggttcaggaaatcggccgtcaacttcacgtaaca
cctcgggcggtgaccgttgatacgcaacgggaagctttgcagggggcggattttgtaatc
aacgtggttcaagtaggcggatttgaggcgacccgacgggattttgacatacccgaacgg
tacgggatcgtccagactatcggggataccctgggggtcggcgggattttccgtgcgctt
cggaccattccggtggtgcttgatttggtccgagatatggaagacgtatgtccggaggcc
gtcttgttaaactacacgaacccgttgtccatggtcgtcatggcaattgccaggatcagc
ggcatccaggcgtacgggctatgtgaaagtcctcgcaccaccgcggacactttgtcccgc
taccttgaaattccgccggaccggttaaactggatgaccgccggcattaaccacatggcg
tgggttctccgattggaggcggagggccgggacctatacccgacattgagatcgttggcc
gatgatcccgagacctggcgaaaggatgcggtgcgattcgaattaatgaaagcgttcggc
tatttcgtgaccgagtcgagcgaacataacgccgaatacggtccttggttcataactcac
cccgacgagattcggcgcctgggcattccccttggcgaactgctgcggcgaagcgccaac
tatctccgcgacttcgaggcctataaaaccgagggtattcgcgaagattttacttttccg
agacacccgccttttcaatatgccgccgagctgatcacacattggatgactggagaagac
ctgacgttttacggtagcgtcatgaatcacggcttaatagacaacatcatgccgaccatt
gccgtggaggttccctgcgtattgactcaaggtgagatttttccggtgcatgtgggcccc
ttgccggacgtgctggcggctttgaataatcgcgccggtgcgattcaggatctgacagtt
caggcagtgcttcgacgtaaccgggaggacttgtatcatgccttgttattggacccggtc
gtgtcgagccgattaaccgtggatcaaaccgtttcgttggccaacgagttgttggaggcc
cataaggggatcgttcccgaacttaaaacccgtcgcgtcttcgggaacacgtcattctcc
ggggagggtacatga

DBGET integrated database retrieval system