KEGG   Sulfobacillus acidophilus TPY: TPY_2294Help
Entry
TPY_2294          CDS       T01576                                 

Definition
nickel-dependent hydrogenase large subunit
Orthology
K06281  
hydrogenase large subunit [EC:1.12.99.6]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
Nitrotoluene degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:say00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TPY_2294
Enzymes [BR:say01000]
 1. Oxidoreductases
  1.12  Acting on hydrogen as donor
   1.12.99  With other acceptors
    1.12.99.6  hydrogenase (acceptor)
     TPY_2294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2149149..2150750)
Genome map
AA seq 533 aa AA seqDB search
MEIEVHALGRVEGDLDVKVHVEDGVVVDAWTEASMFRGFEMILKGKDPQAGLIVTPRICG
ICGGSHLYKSVYALDTAWQTEVPPNATLVRNIAQACETIQSVPRWFYALFAIGLTHRNYA
KSPLYDEVVRRWAPFVGESYEIGVTLSNKPVEVYAIFGGQWPHSSFMIPGGVMCAPTLTD
ITRSISILEYFQQNWLEKVWLGCSIDRWLQNQSWDDVLGWLEESSSHQNSDLGLFLRFCM
DVGLDKYGAGPGRFLAMGTFFNPDRYRRPTIETRNAALISRSGIYDGKTFHDFDQARVRE
DHTHAFYRGTGSLHPFDGVTEPIDPNEGRLLGKYTWAKAPRYDIPGVGELAMETGPLARQ
VMAGRPGAESWQDYDPLMLNVINQVGPSVMVRVLGRMHEGVKYLKRVREWLSQINLHEPF
YIKPPELPEGRGFGATEAARGALADWIVLKDGKIENYQVVTPTAWNIGPRDRNNNVGPIE
KAMIGSPVTNPEDPVELAHVAQSYDSCLVCTVHVYDAKTQRELSRFEVGSGSC
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggagatcgaggttcacgcgcttgggcgtgttgagggggatctggatgtcaaagttcat
gtggaagatggcgtagtcgtcgatgcatggacggaagccagtatgttccgcgggtttgaa
atgatcctcaagggaaaggatcctcaagcggggttgatcgtgacgccgcgtatctgcggg
atttgtggggggagtcacctctataagtcggtctacgccctcgatacggcatggcagacg
gaagtgcctcccaatgcgacattggtgcgaaatattgctcaagcttgcgagacgattcaa
agcgttccgcgatggttttatgcgttgtttgccattggattgacacaccgcaattatgcc
aagagtccgttatatgacgaagtggtacggcgttgggccccgtttgtgggcgaaagctac
gaaatcggcgtcacgttgtcgaataaaccggttgaagtctatgctattttcggaggccaa
tggccgcattccagttttatgatccccggtggtgtcatgtgtgcgcccaccttaaccgat
attacacggtcgatctcgattctggaatattttcaacaaaattggttagaaaaagtctgg
cttggttgctccatcgaccgttggcttcaaaaccaaagttgggatgatgtgctcgggtgg
ctcgaggaaagctcgtcgcatcagaactccgacctcggtctatttttgcggttttgcatg
gatgtcgggctcgacaaatatggagcaggacctgggcggtttttggccatggggacgttt
ttcaatcccgatcgctatcggagaccaaccatcgaaacgcgtaacgctgccttgattagc
cgttcggggatttatgacggaaagaccttccatgattttgatcaagcgcgagtgcgagaa
gatcacacccatgctttctatcgcggaacaggctctttgcatccattcgatggtgttacg
gaacccatcgatcctaacgaaggccgcctcctcggaaaatatacctgggccaaagcgccc
cgctacgacattccaggcgtaggcgagctggcaatggaaactgggccgttggcacgacaa
gtcatggccggtcgaccgggggccgagagttggcaggactatgatccgttgatgttaaat
gtgatcaaccaggtcgggccgagcgtgatggtccgcgtattgggacgaatgcacgaaggc
gtcaagtatcttaagcgggtccgggagtggttatctcagattaatctgcatgaaccgttc
tacattaaacccccggagcttcccgaaggacgcgggtttggggcgaccgaggcggctcgc
ggtgccttagccgactggattgtgcttaaagacggaaaaatcgaaaattatcaggttgtg
accccgaccgcctggaatattgggcctcgagaccggaacaacaatgtgggtcccatcgag
aaagccatgattggcagtccggtgacgaatccggaagatccggtggaattggctcatgtg
gctcagagctacgattcatgtttggtgtgcactgtgcacgtctatgatgccaagacccaa
agagaattgtcccgatttgaggtagggagtggttcgtgttga

DBGET integrated database retrieval system