KEGG   Sulfobacillus acidophilus TPY: TPY_2482Help
Entry
TPY_2482          CDS       T01576                                 

Gene name
cheB
Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:say02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:say02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2303968..2305017)
Genome map
AA seq 349 aa AA seqDB search
MNEAEDRGVRVVVVDDSAFFRYELGSRLVRRGWQLVASVASGEEALKVVPLLQPDLVMMD
VVMPGMGGMAAVRALRRRWPGLILMMSGQSDTGTAATWDALEAGANDFIPKPHADQTLDA
MVRQIVDRYRALAPRGSEGPQPEKGTTFDKEPRTEGFKAIVIGASTGGPQALSFLLETIR
LAPRIPVLIVQHMPSGFTRSFAERLADRLGYPVQESPPEGDMVPWDPPPVIVAAGGKHLR
VSRQGAWSESGERLHGVIPSVDVTLSDAVSVFGRDLGVVILTGMGEDGAQGALAVHQRGG
TVIAESRETALVWGMPRAVFEAGAADAVWPLGRISLWLRQVIQHGVPLR
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaggcagaggatcgcggagtgcgggtcgtcgtggtcgacgactccgcctttttt
cgctatgaattgggatcccggttggtgcgccgagggtggcagttggtggccagcgtggcc
tccggagaagaagcgttaaaagtagtcccgcttcttcagccggatttggtaatgatggat
gtcgtcatgccgggcatgggggggatggcggcggtccgggctttaaggcggcggtggccc
ggattgattcttatgatgtcgggccaaagcgataccggcacggcggccacctgggatgcg
ctggaggctggggctaacgactttattccgaagccgcatgcggatcaaacattggatgca
atggttcgtcaaattgtcgaccggtatcgggctttggcgccgcgggggtctgagggtccg
cagcccgagaaaggcaccaccttcgacaaggaaccacggaccgaaggattcaaagcgatc
gtcatcggggcttcgaccggcgggccgcaagcgttgtcgtttttgttggaaactattcgg
ttggctccccgcattccggtactcattgtacaacacatgccctccggctttacccgttcg
ttcgccgaacggttggctgatcggttgggatacccggttcaagagtcgcctccggaaggg
gacatggtgccttgggatccgcctccggtgattgtggcggcgggcggcaaacatctgcgc
gtcagccgtcagggcgcttggagcgagtcgggcgaacggctgcatggggtcattccgtcg
gtcgacgtcaccctgagcgatgcggtttccgtgtttggccgcgacttgggcgtggtcatt
ttgaccggcatgggagaagacggggctcaaggggctttagccgtgcatcagcggggaggg
accgtcattgccgaatcgcgggaaaccgctttggtgtggggcatgccgcgggcggttttt
gaggccggcgcagccgatgcggtgtggccgcttgggcgcatcagtttatggttaagacag
gtgattcaacatggggtaccgctacgatga

DBGET integrated database retrieval system