KEGG   Sulfobacillus acidophilus TPY: TPY_2520Help
Entry
TPY_2520          CDS       T01576                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
say00010  Glycolysis / Gluconeogenesis
say00620  Pyruvate metabolism
say00640  Propanoate metabolism
say00680  Methane metabolism
say01100  Metabolic pathways
say01110  Biosynthesis of secondary metabolites
say01120  Microbial metabolism in diverse environments
say01130  Biosynthesis of antibiotics
say01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:say00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TPY_2520 (acs)
   00620 Pyruvate metabolism
    TPY_2520 (acs)
   00640 Propanoate metabolism
    TPY_2520 (acs)
  Energy metabolism
   00680 Methane metabolism
    TPY_2520 (acs)
Enzymes [BR:say01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TPY_2520 (acs)
Lipid biosynthesis proteins [BR:say01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TPY_2520 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEJ40680
UniProt: F8I2P3
Position
2344548..2346467
Genome map
AA seq 639 aa AA seqDB search
MAYMGKTTARRSVMASDDIEKFLDNSREYPPPAHVATWNIPRWDEAYESARDPIAYWHRI
AQNRTWLTPYDTVKTGDWPDVAWFSGGVTNITLDCLDRHLDTIGDQIAYIALTEQGLDRQ
LTYRELAAEVNQIAGALKAVGVHRGDRVIIYMPLIWQGIAAMLATARIGAIHSVVYAGLG
TAALRNRIDQAEAKVVLTADVTWRRGKAIPLLPIVEEAVRDASDVTPIVLRRDPATVLPE
HFRDWASWLLDADVPVSAEPMNAEDPLFILFTSGTTGSPKGAVFVHGGYSVGVPELLRQA
IYYQPGDVFWCMSDIGWIVGHSLIVYGPLINGMTTVIREGAPDAPTPDAVWDTIERYRVT
KLYTAPTTVRMLRRIGTEAAKAHDLSSLQLVACAGEPLNPEAWRWLYDDVGHQQIAVVDN
WWQTETAAPTIGTWPSLPVRPGKAGKPFPGVGVRIVDRTGHPLPAGQGGLLTLTEPLPQM
FRDVWNNHARYREYFTAIPGSYLSGDVAVQDEAGYIEVLGRADDVLNVAGHRVGTADVES
ALVSHPWVAEAATIGIPDPLKGEAIVVYVVLRTHPDISDAEITETLIRHVRHELGPIATP
EAIRIVDKLPKTRSGKIMRRVVKAWELGQDPGDLTTLDE
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atggcatatatggggaaaacgaccgctaggaggagtgttatggcctcggacgatatcgaa
aaattcttggataactctcgtgagtacccgcctccggctcatgtggcgacttggaacatc
ccccgctgggatgaggcctatgagagcgcccgggacccgatcgcctattggcatcgcatc
gcccaaaaccgcacctggcttaccccttatgacaccgtgaagacaggagactggcctgac
gtggcctggttttccggcggcgtcacgaatattaccttggattgtctggaccgccacctc
gacaccatcggcgaccagattgcctacatcgcccttacggaacagggattagaccgacaa
ctgacctaccgcgaactggccgccgaagtgaatcaaatcgccggagcccttaaagccgtc
ggtgttcaccgcggcgaccgcgtgattatctacatgcccttaatttggcaaggcattgcg
gccatgctggccacggcccgcatcggtgccattcatagtgtggtgtatgccggactcggc
acggccgccttacggaaccggattgaccaagccgaggcgaaggtcgtgttgaccgccgat
gtgacgtggcgccggggaaaagcgattcccttactccccattgtggaagaagcggtccgc
gacgcctcggacgtgaccccgatcgtactgcgtcgggatcccgcgaccgttctccctgag
cactttcgcgattgggcaagctggcttttggacgcggacgtgcccgtatcggcggaaccc
atgaacgcggaagatcccctcttcattctttttacgtcgggcaccacaggtagccccaaa
ggagccgtttttgtccacgggggctattccgtcggcgtccccgaactcttacgccaagcc
atttattatcaaccgggtgatgttttttggtgcatgtccgatatcggatggattgtcggt
cattcgctgatcgtctacggccccttgattaacgggatgacgaccgtaattcgggagggg
gcacccgacgcgccgacacccgatgcggtctgggataccatcgaacgctaccgggtcacc
aaactttataccgccccgacgaccgtccggatgctccgccgcatcggcaccgaagcggcc
aaggcccatgacctgtcgtccctgcaactggtcgcctgtgcgggtgaacccctcaatccc
gaagcgtggcgttggctatatgacgacgtgggacaccaacagattgccgtggtggataac
tggtggcaaaccgaaacggcggctcccaccatcggcacctggccatccttgccggtccgt
cccggaaaagccggcaaaccgtttcccggagtcggggtacgcattgtcgatcgtaccgga
caccctctgccggccgggcaaggcggcctcttgacgttgacggaaccgctgccccaaatg
tttcgcgatgtgtggaacaaccatgcccgctatcgggaatatttcacggccatccccggc
tcctatctgtccggcgatgtcgccgtccaagacgaagccggttatattgaggtgctgggc
cgggccgatgacgtcctcaatgtcgccggccaccgtgtcggcacggccgatgtggaatcg
gctctggtctcccatccctgggtcgcggaagcggccaccatcggcattccggatcccctg
aaaggagaggccatcgttgtctacgtcgtgttgcgcacgcacccggatatttctgatgcc
gagataaccgaaaccctcatccggcacgtccggcatgagttaggacccatcgcgacaccg
gaagcgattcgcatcgtcgacaagctgccgaaaacgcggagtggaaaaattatgcgccgc
gtcgtgaaagcttgggagcttggccaggatccgggggatttgacgacccttgacgaatag

DBGET integrated database retrieval system